KEGG   Haloferax volcanii: HVO_0818Help
Entry
HVO_0818          CDS       T01200                                 

Gene name
thrC2
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
hvo  Haloferax volcanii
Pathway
hvo00260  Glycine, serine and threonine metabolism
hvo00750  Vitamin B6 metabolism
hvo01100  Metabolic pathways
hvo01110  Biosynthesis of secondary metabolites
hvo01120  Microbial metabolism in diverse environments
hvo01230  Biosynthesis of amino acids
Module
hvo_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hvo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HVO_0818 (thrC2)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HVO_0818 (thrC2)
Enzymes [BR:hvo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HVO_0818 (thrC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADE03841
UniProt: D4GUE0
Position
737956..739125
Genome map
AA seq 389 aa AA seqDB search
MQTSDSFSGLVCTETGDEYDAAATGPSDADAPLDPAYDLDAVEWDAETLAARPFDTMWRY
RELLPFAEPVTANEGATPLVAADALAEEAEVGSLLIKDEGRNPTGTFLDRGFSLAVTAAR
EADAEVVAHASPGNGAQSAASYAGLVDARSYGFVPSRTPFPNKAMVNVHGGQMKVVGGRY
PDALSALHEQLKSDWHTLQEFDNPYRHDGAKTIAYEVAERLDWSVPDWVVVPVSTGELAY
GVYKGFSDLVELGLVESMPKLVAAQSVGCSPVATAWEADSDTHEAWNQPDTIVGELEIPD
PTGGSLALRAVRESGGAAVAVSDDDALESAVTAAQSAGVEVGPAGGVALAGAWELADEFD
EDDTVVVVNTESGTKNADILRSHLMGQGV
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgcagacgtctgacagcttctccgggctggtgtgcacggagaccggcgacgagtacgac
gcggccgcgaccggcccgagcgacgccgacgcgccgctcgaccccgcctacgacctcgac
gcggtcgagtgggacgccgagacgctcgccgcgcgccccttcgacacgatgtggcgctac
cgcgaactgctcccgttcgcggagccggtgacggcaaacgagggcgcgacgcccctcgtc
gcggccgacgcgctcgccgaggaggccgaggtcggttcgctcctcatcaaggacgagggc
cgcaacccgaccggaacgttcctcgaccgcggcttctcgctcgccgtcaccgccgcgcgc
gaggccgacgccgaggtcgtcgcgcacgcctcgcccggcaacggcgcgcagtcggcggcc
tcctacgcgggcctcgtggacgctcgctcctacggcttcgtcccctcgcggacgccgttc
ccgaacaaggccatggtgaacgtccacggcggccagatgaaggtcgtcggcgggcgctac
cccgacgcgctttcggcgctccacgaacagctcaaaagcgactggcacacgctccaggag
ttcgacaacccctaccgccacgacggcgcgaaaaccatcgcctacgaggtcgcagagcgc
ctcgactggtcggtccccgactgggtcgtcgtccccgtctcgaccggcgaactcgcctac
ggcgtctacaagggcttttccgacctcgtcgaactcggattggtcgagtcgatgcccaag
ctcgtcgcggcgcagtcggtcggttgctcgcccgtcgccaccgcgtgggaggccgacagc
gacactcacgaggcgtggaaccagccggacaccatcgtcggtgaactggagattcccgac
cccacgggcgggtcgctcgcgctccgcgccgtccgcgagtccggcggtgcggccgtcgcc
gtcagcgacgacgacgcgctcgaatccgccgttactgccgctcagtccgccggcgtcgag
gtcggcccagcgggcggcgtcgcgctcgccggcgcgtgggaactcgcggacgagttcgac
gaagacgacacggtcgtcgtcgtcaacaccgaatccgggacgaagaacgccgacatcctc
cgcagccacctgatgggacagggcgtctga

DBGET integrated database retrieval system