KEGG   Haloferax volcanii: HVO_0894Help
Entry
HVO_0894          CDS       T01200                                 

Gene name
acs1
Definition
(GenBank) acyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hvo  Haloferax volcanii
Pathway
hvo00010  Glycolysis / Gluconeogenesis
hvo00620  Pyruvate metabolism
hvo00640  Propanoate metabolism
hvo00680  Methane metabolism
hvo00720  Carbon fixation pathways in prokaryotes
hvo01100  Metabolic pathways
hvo01110  Biosynthesis of secondary metabolites
hvo01120  Microbial metabolism in diverse environments
hvo01130  Biosynthesis of antibiotics
hvo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hvo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HVO_0894 (acs1)
   00620 Pyruvate metabolism
    HVO_0894 (acs1)
   00640 Propanoate metabolism
    HVO_0894 (acs1)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    HVO_0894 (acs1)
   00680 Methane metabolism
    HVO_0894 (acs1)
Enzymes [BR:hvo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     HVO_0894 (acs1)
Lipid biosynthesis proteins [BR:hvo01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   HVO_0894 (acs1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADE04845
UniProt: D4GUW1
Position
811838..813826
Genome map
AA seq 662 aa AA seqDB search
MADGDTELEARLVEQEEFEPSEEFVAQANVSDPAVYDEFEENWPDCWERAAEMLDWDEKY
DEVLDDSNPPFYEWFTGGKLNVSYNCVDRHVENGDKNRVAIKWEGEHGETRTYTYQDLYR
EVNEFAAALRDLGVEEDDVVTLYMPMIPELPIAMLACARIGAPHSVVFGGFSAEALATRM
NAADSRFLVTCDGYYRRGDPLDHLDKANEGLDGVDHGVDATVVVDRLGDDGFDHDLKGNQ
HDWDDLLDEHAGERIDPVERDAEDMLFLMYTSGTTGQPKGVKHTTGGYLAYAAWTSHAVL
DIEKEDTYWCSADIGWITGHSYIVYGPLALGTTTVMYEGTPDFPNRDRLWDIIEKYAVDI
FYTAPTAIRAFMKWGSRFPEQHDLSSLRLLGTVGEPINPRAWKWYYKHIGNEDCPVVDTW
WQTETGGMMITTLPGIKKMKPGSAGPPLPGIDAQIVDTSGKQVDAGRAGYLTVNKPWPGM
LRTLYKNDERFIQEYWQEYSDTDSDDPDDWVYFPEDGAKIDGDDYITILGRVDDVINVSG
HRLGTMEIESAIVGVEGVAEAAVVGGNHEVKGEAVYAYVITEEGQDEDDEMRGRIIEGVE
DAIGPIARPEMVVFTPELPKTRSGKIMRRLLEEIANGEELGDTTTLRNPEVVESIQRQVE
SE
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atggcagacggtgacaccgaactggaggcacggctggtcgagcaggaggagttcgaaccc
tccgaggagttcgtcgcgcaggcgaacgtctccgacccggccgtctacgacgagttcgag
gagaactggcccgactgctgggagcgggccgccgagatgctcgactgggacgagaagtac
gacgaggtactggacgattcgaacccgccgttctacgagtggttcacgggcggcaagctc
aacgtctcgtacaactgcgtggaccgccacgtcgaaaacggggacaagaaccgcgtcgcc
atcaagtgggagggcgaacacggcgagacgcggacgtacacgtatcaggacctctatcgc
gaggtgaacgagttcgcggccgcgctgcgcgacctcggcgtcgaggaagacgacgtggtc
acgctctacatgccgatgattccggaactgccaatcgccatgctggcctgcgcccgcatc
ggcgcgccgcactcggtcgtcttcggcggcttctccgccgaggcgctggcgacgcggatg
aacgccgcggactcccgcttcctcgtcacctgcgacggctactaccgccgcggcgacccg
ctcgaccacctcgacaaggccaacgagggcctcgacggcgtcgaccacggcgtcgacgcg
accgtcgtcgtcgaccgactgggtgacgacggcttcgaccacgacctgaagggcaaccag
cacgactgggacgacctcctcgacgagcacgccggcgagcgcatcgaccccgtcgaacgc
gacgccgaggacatgctgttcctgatgtacacctcggggacgacgggccagccgaagggg
gtcaaacacaccaccggcggctacctcgcgtacgccgcgtggacctcccacgcggtcctc
gacatcgagaaggaagacacctactggtgttcggccgacatcggctggattacgggccac
tcgtacatcgtctacgggccgctcgcgctcggcacgacgacggtgatgtacgaggggacg
cctgacttccccaaccgcgaccgcctgtgggacatcatcgagaagtacgcggtcgacatc
ttctacaccgcgccgacggcgattcgcgcgttcatgaagtggggcagccggttccccgaa
cagcacgacctgtcgagcctccgcctgctcggcacggtgggcgaacctatcaacccgcgc
gcgtggaagtggtactacaagcacatcggcaacgaggactgcccggtcgtggacacgtgg
tggcagaccgagaccggcgggatgatgataacgacgctcccgggaatcaagaagatgaaa
cccggctccgccgggccgccgctgccgggcatcgacgcccaaatcgtcgacacgagcgga
aaacaggtcgacgccgggcgcgcgggctatctcacggtgaacaagccgtggcccggcatg
ctccggacgctctacaagaacgacgagcgcttcattcaggagtactggcaggagtactcc
gacaccgacagcgacgaccccgacgactgggtctacttccccgaggacggcgcgaaaatc
gacggcgacgactatatcaccatcctcgggcgcgtcgacgacgtcatcaacgtctcgggc
caccgcctcgggacgatggaaatcgagtcggccatcgtcggcgtcgagggcgtcgcggag
gccgcggtcgtcggcggcaaccacgaggtgaaaggcgaggccgtctacgcctacgtcatc
accgaggagggtcaggacgaagacgacgagatgcgggggcgcatcatcgagggcgtcgag
gacgccatcggccccatcgctcgccccgagatggtcgtgttcacgccggaacttccgaag
acgcggtctggcaagattatgcgtcggctcctcgaagagattgcgaacggcgaggaactc
ggtgacacgacgacgcttcggaaccccgaagtcgtcgagtcgattcagcggcaggtcgaa
agcgagtaa

DBGET integrated database retrieval system