KEGG   Haloferax volcanii: HVO_1496
Entry
HVO_1496          CDS       T01200                                 
Symbol
ptsI
Name
(GenBank) phosphotransferase system component I
  KO
K08483  phosphoenolpyruvate-protein phosphotransferase (PTS system enzyme I) [EC:2.7.3.9]
Organism
hvo  Haloferax volcanii
Pathway
hvo02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:hvo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    HVO_1496 (ptsI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hvo02000]
    HVO_1496 (ptsI)
Enzymes [BR:hvo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.9  phosphoenolpyruvate---protein phosphotransferase
     HVO_1496 (ptsI)
Transporters [BR:hvo02000]
 Phosphotransferase system (PTS)
  Enzyme I and HPr
   Enzyme I [TC:8.A.7]
    HVO_1496 (ptsI)
SSDB
Motif
Pfam: PEP-utilizers_C PEP-utilisers_N PEP-utilizers
Other DBs
NCBI-ProteinID: ADE03888
UniProt: D4GYE2
Position
complement(1364701..1366398)
AA seq 565 aa
MTERTLSGIGVTPLSGVGTVVWYRPDADLPEPPAPVDVDAEAELARFEDARAAAEDELEA
ERERTAERVGEEEAAVFDAHVQFLNDPQITDGVSDAIESGLPAEHAVQETFTEFVEQFEN
MGGRMGERADDLRDVRDRLVRVLSDGERVDLSSLPEGSVVVAERLTPSDTAQLDPERVAG
FVTVTGGRTSHAAIFARSLALPAIVGVGEELQSVEDGTEVVVDGESGDLVVDPSDERKEA
AAAAADVDIRHEAVETADGVDIEVAANIGTLADLGPAVDRGADGVGLFRTEFLFLDRESP
PDEDEQYEAYVEALESFDGGRVVVRTLDIGGDKPVPYLDLPDEENPFLGERGIRRSLGPD
ADLFETQVRALLRAAASADGANLSVMLPLVSTVEELRAGRERFESVAADLDAEGVANELP
EFGIMVETPAAAFMADQFAPHVDFFSIGTNDLAQYVMAAERGNERVSELGDYRQPAVLRA
IDATVSAAEGEDCWVGMCGEMAGDPDLTELLVGLGLDELSMSAVTVPQVKAAVAETDTAD
ARDLAERVLQADTKAEVAEILTLDQ
NT seq 1698 nt   +upstreamnt  +downstreamnt
atgaccgaacgaaccctctccggcatcggcgtgacaccgctttcgggcgtcggcaccgtc
gtctggtaccgcccggacgcggacctccccgagccgccggccccggtagacgtggacgcg
gaggccgaactggcccgcttcgaggacgcccgcgcggccgccgaagacgaactcgaagcc
gagcgcgagcggaccgcagaacgcgtcggcgaggaggaggcggcggtgttcgacgcgcac
gtccagttcctcaacgacccgcagataaccgacggcgtctcagacgccatcgagagcggg
ctcccggccgaacacgccgttcaggagacgttcaccgagttcgtcgagcagttcgagaac
atgggcggtcgcatgggcgagcgcgccgacgacctccgcgacgtgcgcgaccgactcgtg
cgcgtcctctcggacggcgagcgcgtcgacctctcgtcgctgccggaggggagcgtcgtc
gtcgcggagcggctcacgccgagcgacacggcgcaactcgacccggagcgcgtcgccggc
ttcgtcaccgtgacgggcggccgcacctcccacgcggccatcttcgcgcgctcgctcgcc
ctgccggccatcgtcggcgtgggcgaggagctccagtccgtcgaggacggcaccgaggtc
gtcgtcgacggcgagtcgggcgacctcgtggtcgacccgagcgacgagcgcaaggaggcc
gccgcggccgccgccgacgttgacatccgacacgaggcggtcgagaccgcagacggcgtc
gacatcgaggtcgccgccaacatcggcacgctggcggacctcgggccggccgtcgaccgc
ggggccgacggcgtcggcctgttccgcaccgagttcctcttcctcgaccgcgagtcgccg
ccggacgaagacgagcagtacgaggcgtacgtcgaggcgctcgaatcgttcgacgggggc
cgcgttgtcgtccgaaccctcgacatcggcggcgacaagccggtcccgtatctcgacctg
ccggacgaggagaacccgttcctcggcgagcgcggcatccgccggtcgctcggtccggac
gcggacctcttcgagacgcaggtccgcgcgctcctgcgcgcggcggccagcgccgacggc
gcgaacctgtcggtgatgctcccgctcgtctcgacggtcgaggagcttcgcgccggccgc
gagcggttcgagtcggtcgccgccgacctcgacgccgagggcgtcgcaaacgaactgccc
gagttcggcatcatggtcgagacgcccgccgcggcgttcatggccgaccagttcgcgccg
cacgtcgacttcttcagcatcgggacgaacgacctcgcgcagtacgtgatggccgccgag
cgcggcaacgagcgcgtttctgagctcggagactaccggcagccggcggtcctccgcgcc
atcgacgccaccgtctcggcggccgaaggtgaggactgctgggtcggcatgtgcggcgag
atggcgggcgacccggacctcaccgaactgctcgtcgggctcggcctcgacgaactgagc
atgagcgccgtgacggtgccgcaggtcaaggcggccgtcgcggagaccgacaccgcggac
gcccgcgacctcgcggagcgcgtcctccaggccgacacgaaggctgaagtcgcggaaatc
cttacactagaccaatga

DBGET integrated database retrieval system