KEGG   Haloferax volcanii: HVO_1497
Entry
HVO_1497          CDS       T01200                                 
Symbol
ptsH1
Name
(GenBank) phosphocarrier protein HPr
  KO
K02784  phosphocarrier protein HPr
Organism
hvo  Haloferax volcanii
Pathway
hvo02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:hvo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    HVO_1497 (ptsH1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hvo02000]
    HVO_1497 (ptsH1)
Transporters [BR:hvo02000]
 Phosphotransferase system (PTS)
  Enzyme I and HPr
   Phosphocarrier protein HPr [TC:8.A.8]
    HVO_1497 (ptsH1)
SSDB
Motif
Pfam: PTS-HPr
Other DBs
NCBI-ProteinID: ADE03675
UniProt: D4GYE3
Position
complement(1366402..1366671)
AA seq 89 aa
MERTVTVVPEDGLHARPASKFVETANKFDADVQLGRADEDDLVPAASMLAVTGLGVGHDE
SVRLVAEGDDAEAALDALEDILSTPEAKQ
NT seq 270 nt   +upstreamnt  +downstreamnt
atggagcgaaccgtcacggtcgtccccgaagacgggctgcacgcccgcccggcctcgaag
ttcgtcgagaccgcaaacaagttcgacgccgacgtacagctcggccgcgccgacgaggac
gacctcgtccccgccgccagcatgctcgccgtcaccggcctcggcgtcggccacgacgag
tccgtccgactcgtcgccgagggcgacgacgcggaagcggcactcgacgccctagaggat
atcctttccacgcctgaagccaaacagtaa

DBGET integrated database retrieval system