KEGG   Haloferax volcanii: HVO_2056Help
Entry
HVO_2056          CDS       T01200                                 

Gene name
agl13
Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
hvo  Haloferax volcanii
Pathway
hvo00521  Streptomycin biosynthesis
hvo00523  Polyketide sugar unit biosynthesis
hvo01130  Biosynthesis of antibiotics
Module
hvo_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:hvo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    HVO_2056 (agl13)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HVO_2056 (agl13)
Enzymes [BR:hvo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     HVO_2056 (agl13)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom FdtA Cupin_2
Motif
Other DBs
NCBI-ProteinID: ADE02686
UniProt: D4GU69
Position
1905450..1905920
Genome map
AA seq 156 aa AA seqDB search
MPNIHDVEVRDLQVNADQRGHLVEVFRSDWDEYEIDPEMSYYSMTYPGVVRAWHRHLEGQ
IDHFVCPKGRITVGIYDDREDSPTQGELDTFVIGEHNQQVIRIPGDCWHGFKAIGDEPSL
LINYPTNLYDYEDPDEERIPYDDDRIPYDWNAEIHG
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgccaaacatccacgatgtcgaagtccgtgacctccaagtcaacgccgaccagcgaggc
cacttggtcgaagtgttccgtagcgactgggacgaatacgaaattgacccggagatgtcc
tactactcgatgacgtatcccggagtcgtgcgggcctggcatcgccatctcgaaggccag
atcgaccacttcgtctgcccgaagggtcgtatcacggtgggcatctacgacgaccgcgaa
gactcgcccacgcaaggagaactcgacacgttcgtcatcggcgagcacaaccaacaagtc
atccgcatcccaggtgactgctggcacggattcaaggctatcggcgacgagccgtcgctg
ctcatcaactacccgacgaacctctacgactacgaagatcccgacgaagagcgcattccg
tacgatgacgaccggattccgtacgactggaacgcggaaatccacggctaa

DBGET integrated database retrieval system