KEGG   Haloferax volcanii: HVO_2105Help
Entry
HVO_2105          CDS       T01200                                 

Gene name
tpiA2
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hvo  Haloferax volcanii
Pathway
hvo00010  Glycolysis / Gluconeogenesis
hvo00051  Fructose and mannose metabolism
hvo00562  Inositol phosphate metabolism
hvo01100  Metabolic pathways
hvo01110  Biosynthesis of secondary metabolites
hvo01120  Microbial metabolism in diverse environments
hvo01130  Biosynthesis of antibiotics
hvo01200  Carbon metabolism
hvo01230  Biosynthesis of amino acids
Module
hvo_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hvo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HVO_2105 (tpiA2)
   00051 Fructose and mannose metabolism
    HVO_2105 (tpiA2)
   00562 Inositol phosphate metabolism
    HVO_2105 (tpiA2)
Enzymes [BR:hvo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HVO_2105 (tpiA2)
Exosome [BR:hvo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HVO_2105 (tpiA2)
  Exosomal proteins of bladder cancer cells
   HVO_2105 (tpiA2)
  Exosomal proteins of melanoma cells
   HVO_2105 (tpiA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM His_biosynth B12-binding
Motif
Other DBs
NCBI-ProteinID: ADE03233
UniProt: D4GUQ2
Position
complement(1967896..1968573)
Genome map
AA seq 225 aa AA seqDB search
MNLPYPHFQVNFKVYPDTSGEDALAFARLLETIEAETDARFVLTPQLPDIRLITEHTDLA
VTAPAMDAVEPGRGMGKILPETVADAGADGVVINHAENRDTLSDLVWKTERCRDLDLDSV
VCVDSIEMGRAVAEFDPDSMIYEMPEDISSDRAITQTHPDRVRDFMSMVERENPRTRVLV
GGGISTAEDVRLAFEQGGHATGAASAVSLASEPEPLLRDIATSFP
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttccgtacccccactttcaggtcaacttcaaggtgtatccggacacgagcggc
gaggacgcgctcgcgttcgcgcggctgctcgaaacgatagaggcggagaccgacgcgcgc
ttcgtgttgacgccgcaactgccggacatccggctgataaccgaacacaccgacctcgcc
gtcaccgcgcccgcgatggacgccgtcgagcccggtcgcgggatggggaaaatcctcccg
gagaccgtcgcagacgcgggggccgacggcgtcgtcatcaaccacgcggagaaccgcgac
acgctgtccgacctcgtgtggaaaaccgagcgctgtcgcgacctggacctcgactcggtc
gtctgcgtcgacagcatcgagatgggtcgcgcggtcgcggagttcgaccccgactcgatg
atatacgagatgcccgaggacatctcgtcggaccgcgcgattacgcagacgcaccccgac
cgcgttcgcgacttcatgtcgatggtcgagagggagaatccgcgcactcgcgtcctcgtc
ggcggcggcatctcgaccgccgaagacgtccgcctcgccttcgaacagggaggtcacgcg
accggtgccgcgtcggccgtgtcgctcgcgtcggagccggagccgctcctccgcgacatc
gccacgagtttcccctga

DBGET integrated database retrieval system