KEGG   Haloferax volcanii: HVO_2996Help
Entry
HVO_2996          CDS       T01200                                 

Definition
(GenBank) transport protein (probable substrate phosphate/sulfate)
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
hvo  Haloferax volcanii
Brite
KEGG Orthology (KO) [BR:hvo00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    HVO_2996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ADE02634
UniProt: D4GY91
Position
complement(2825667..2826827)
Genome map
AA seq 386 aa AA seqDB search
MVEALLFVGLLVAVFVGFNIGGSSTGVSFGPAVGSGVLGKLAAAALMTGFALLGGWTLGR
EVVAKMGGEIVPQSEFTLAASVAVLFFVGLALLVSNTFGVPASTSMTAVGAIAGLGLANG
SLDSRVMLEIISWWIVAPVIAFWICAVIGRYIYPYLDAWLKLDQSPGALVRLDRDGGFPR
PRLGPNTTYREFGSTVLVVVVACYMAFSAGASNVANAVAPLVGNGALEMNTGILIAGGAI
GLGAFTIARRTLDTVGNDLTQLPILAALIVETVSASLISFLSAIGIPASLAVSATMCIVG
LGWGRATRTVTLGEALSGGEAPQVSVNALTVEREDEVPKMGEEAPDELSAQDLFDPGTTG
RVIFFWMLTPSLSALASYALFSAGIV
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
gtggtagaagcactcctcttcgtcggtctcctggtggcagtgttcgtcgggttcaacatc
ggcggctcgtccacgggggtctccttcggtcccgcggtcgggagcggtgtgctcgggaaa
ctcgccgcagcggccctgatgacggggttcgcgctcctcggcgggtggacgctcgggagg
gaggtcgtcgccaagatgggcggcgaaatcgtcccgcaaagcgagttcaccctcgcggcg
agcgtcgccgtcctctttttcgtcggcctcgcgctgttggtctctaacaccttcggcgtc
cccgcctccacgtcgatgacggcggtcggggccatcgcgggtctcggcctcgccaacggg
tcgctcgactcccgcgtgatgctcgaaatcatctcgtggtggatcgtcgcgcccgtcatc
gccttctggatctgcgcggtcatcggtcggtacatctacccttacctcgatgcgtggctc
aaactcgaccagagccccggtgccctcgtcaggctcgaccgcgacggcggcttcccgcgg
ccgcgactcggcccgaacacgacctaccgcgagttcggcagcaccgtcctcgtcgtcgtc
gtcgcctgttacatggcgttctccgcgggcgcgtcgaacgtcgccaacgcggtcgccccg
ctcgtcggcaacggcgcgctcgagatgaatacgggcatcctcatcgccggcggcgctatc
ggcctcggcgcgttcaccatcgcccgtcggacgctcgacaccgtcggcaacgacctcacg
cagttgcccatcctcgcggcgctcatcgtcgagacggtgagcgcgtcgctcatctccttc
ctgtcggccatcggtatccccgccagcctcgccgtgagcgcgacgatgtgcatcgtcggc
ctcggctggggacgggcgacccgaactgtcactctcggcgaggccctgagcggcggcgag
gccccgcaggtatcggtcaatgccctcaccgtcgaacgcgaggacgaggtgccgaagatg
ggcgaggaagcccccgacgaactctccgcgcaggacctgttcgaccccggcacgaccggg
cgggtcatcttcttctggatgctcacgccctcgctttcggccctcgcgtcgtacgcgctg
ttctccgccggcattgtctga

DBGET integrated database retrieval system