KEGG   Haloquadratum walsbyi DSM 16790: HQ_1856AHelp
Entry
HQ_1856A          CDS       T00375                                 

Definition
(GenBank) homolog to glycine cleavage system protein T
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
hwa  Haloquadratum walsbyi DSM 16790
Pathway
hwa00260  Glycine, serine and threonine metabolism
hwa00630  Glyoxylate and dicarboxylate metabolism
hwa00670  One carbon pool by folate
hwa01100  Metabolic pathways
hwa01110  Biosynthesis of secondary metabolites
hwa01130  Biosynthesis of antibiotics
hwa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hwa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    HQ_1856A
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HQ_1856A
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    HQ_1856A
Enzymes [BR:hwa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     HQ_1856A
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C
Motif
Other DBs
NCBI-ProteinID: CAJ51984
UniProt: Q18J27
Position
complement(1045492..1046868)
Genome map
AA seq 458 aa AA seqDB search
MANSEDHPNYPSIDQSDRTLPRNLRQTGDPGIEMLVSTRVRKSPFFDKSFNEEGAWRCTV
YNRIYHPRGLVEPEDGGAMAEYDALTEAVTLWDVAVERQIRVKGPDAEALTNYVITRDAT
EIDPMHGKYVILCNEDGGILNDPILLRVAEDEFWFSISDSTLMQWIEGVNVGMDFDVEVD
EIDVAPMQIQGPRSEDVMVDVVGEEVSEIPYYGLMEAEIGGAEVLISQTGFSGEKGFEIY
VRDAMETAERVWDPVLDSVKDHGGMQIAPGHHRRIAAGILSWGQDMDHETSPFQVNLGYQ
VPDNKQADYIGKEELERQQALIDDGEYPFNLKLVGLKMSGEPIRDYAPDFWLVSDPDTGE
ECGYMTSPWWNPDLETNIGLGFVPADKLEAETDALLNDEIYENDLDLEFQVHLPEEYAES
GGPAYATVAEVPFKESVNPSAREQAKLGARQQAEANDD
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatagtgaagatcaccctaactatccaagtattgatcagtctgatcggacgttg
ccacgaaatcttcgccagactggggaccctggcattgagatgctcgtctcgacacgggtc
cgtaaatcaccatttttcgataaatcgttcaacgaggagggtgcctggcgttgtactgtc
tataatcgaatttatcatccacgcggtctcgtcgagcccgaagatgggggagcaatggct
gaatacgacgcactcacagaagctgtcactctttgggatgtcgctgttgagcgtcagatt
cgggtgaagggtccagacgcagaggcattaacaaattacgtaatcacgcgtgatgcaact
gagatagacccaatgcatggaaagtacgttatcttgtgcaatgaggacggtgggattttg
aatgacccaatcctccttcgggtcgctgaggacgaattctggttctcaatctcagattca
acgctgatgcagtggatcgaaggtgtcaatgtcgggatggactttgacgttgaagtcgat
gagattgatgttgcaccaatgcaaattcagggaccacgctctgaggacgtcatggttgat
gtcgtcggtgaagaggtctcagagataccttattatgggctaatggaggcggagattggt
ggtgcagaggtcttgatcagccagactggtttctcaggtgagaaaggatttgagatttat
gttcgtgatgcaatggaaactgctgagcgcgtctgggatccggttcttgattcagtcaaa
gaccatggtggtatgcagattgcaccaggacaccatcgtcggattgcggctggtattctc
tcatggggtcaggatatggatcatgagacttcacccttccaggttaaccttggatatcag
gtaccagataataaacaagcagattacattggtaaagaagaactagagcgccagcaagcg
ttaattgatgatggtgaatatccatttaatctcaaacttgttggactcaagatgtccggt
gaaccaattcgcgattatgccccggatttctggttggtgtcagatccagataccggtgag
gaatgtggatatatgacttcaccatggtggaatccagatctggagacgaatatcggactt
ggatttgttcctgcggacaagcttgaagctgagacagatgcactactgaatgatgagatc
tatgaaaatgatcttgatctcgaattccaggttcatctccctgaagagtacgctgaatcg
ggtggacctgcatatgcaacggtcgcagaggttccattcaaagagtcggttaatccaagt
gctcgcgaacaggcaaaacttggagctagacaacaagctgaagcaaacgacgactaa

DBGET integrated database retrieval system