KEGG   Haloquadratum walsbyi DSM 16790: HQ_3371AHelp
Entry
HQ_3371A          CDS       T00375                                 

Definition
(GenBank) HAD superfamily hydrolase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
hwa  Haloquadratum walsbyi DSM 16790
Pathway
hwa00627  Aminobenzoate degradation
hwa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hwa00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    HQ_3371A
Enzymes [BR:hwa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     HQ_3371A
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_like Hydrolase_6 Hydrolase HAD_2 PGP_phosphatase
Motif
Other DBs
NCBI-ProteinID: CAJ53468
UniProt: Q18EZ6
Position
complement(2733465..2734277)
Genome map
AA seq 270 aa AA seqDB search
MTVRGIIFDVDGTVVRGAEPLPGAIRGVTAVADRGLQRLFVSNNPTKPPTAYETRLESAG
ISVDATEVLTAGAVTKQYLIEYHSNDTIAVVGETGLLELLAADGLSVTDIQTYDSRTKNP
PDVLIASIDRSFDYNTLCLCLDILADESVTFLGTDPDVVIPAAEGDVPGSGAVIDAISNV
TGREPVAVLGKPSQITRKMAIDRLGLPSDDILVVGDRLDTDIALGNGAGMQTVLVETGVT
DVADVENSQINPDHIIPSLGELDSVLELLK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgacagtgcgtggaattatcttcgacgttgatgggacggtagtacgaggtgcagaacca
ctgcctggtgcaatacgtggagtgacagctgttgctgaccgtggacttcagcgattgttt
gtctcaaacaacccaacaaagccaccaacagcgtatgaaacccgacttgagagcgctggg
atttctgtcgatgcaacagaggtgttgaccgctggtgcagtgacaaaacaatatctcatc
gagtatcatagcaacgatactatcgctgtcgttggagaaacgggtcttcttgaattactt
gctgctgatggattatcagtcacagatattcagacatatgatagcagaacaaaaaatcca
cctgacgttcttattgcgtcaattgatcgctcatttgactataatacactctgtctgtgt
ctcgatatccttgcggatgaatctgtgacatttcttggaaccgacccagacgttgttatc
cccgctgcggagggggatgtgcctgggtctggggctgtcattgatgcaatttcgaatgtt
actggtcgcgagccagttgctgtcctcgggaagccaagtcagattacccgtaaaatggcg
attgatcgactaggacttccctcagatgatatccttgttgttggtgaccgacttgatact
gatattgccctcggtaatggggctggaatgcaaacagtacttgttgagactggggtcact
gatgttgcagatgttgaaaactctcaaatcaatccagatcatattattccgtcgcttggt
gaacttgattccgtgttggaattactcaaataa

DBGET integrated database retrieval system