KEGG   Haloquadratum walsbyi C23: Hqrw_1194Help
Entry
Hqrw_1194         CDS       T01942                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hwc  Haloquadratum walsbyi C23
Pathway
hwc00260  Glycine, serine and threonine metabolism
hwc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hwc01100  Metabolic pathways
hwc01110  Biosynthesis of secondary metabolites
hwc01130  Biosynthesis of antibiotics
hwc01230  Biosynthesis of amino acids
Module
hwc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hwc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hqrw_1194 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hqrw_1194 (trpA)
Enzymes [BR:hwc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Hqrw_1194 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB
Motif
Other DBs
NCBI-ProteinID: CCC39161
UniProt: G0LGE1
Position
complement(217279..218127)
Genome map
AA seq 282 aa AA seqDB search
MEGQGLASAFSDGPAFVPYLAAGDPDYESGLAYVEALARGGADIIELGLPFSEPIAEGPT
IQSAIVRSLEAGMTPDQFFEFVTDLDVDPTEVPLVCMTYYNLIYQYGDEEGPRPFVKRAA
DVGLSGFVVPDLPAEESDPLRTACNEFGLDLVFIVAPTTKGDRLNTIMSQVSGYVYVQAR
LGVTGARDDVSTQTESSLSRLDAYDVPKAVGFGIKTGEHAERIVAGGADGIIVGSALVDI
VASGTEAGDSTTTVADRLETKARELTDGVQRGYQKRMPKPDT
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggaaggacaggggcttgcatctgcattctctgacggtccagcattcgttccatatctt
gcagcaggtgacccagattatgaatctgggcttgcatatgtggaggcacttgcacgcggt
ggcgctgatatcattgaacttggacttccgttctcagagccgattgctgaaggaccaaca
atccagagtgctattgttcggtcgcttgaagcagggatgactccagatcagttttttgag
tttgtcaccgacctcgatgtcgatccaactgaggttccactcgtgtgcatgacgtattat
aatctcatctatcaatatggtgatgaggagggtccgcgaccgtttgttaaacgcgccgcg
gatgttggactctcaggatttgttgttccagatttgcccgctgaggaatcagatccgctc
cggacagcttgtaatgagtttgggcttgatcttgtatttattgtcgctccaacgacgaaa
ggcgaccgacttaatacgattatgtcacaggtatcaggatatgtctatgtgcaagcgcga
cttggtgtgactggtgcccgtgatgatgtctcgacacaaaccgagtcaagcctctcgcgg
cttgatgcatacgatgtcccgaaggcagtcggatttggaattaagaccggagagcatgcc
gaacggattgtcgctggtggtgctgatggcatcatcgttggaagtgcattggttgatatc
gttgcttcggggactgaagctggcgattcaacaacaacggttgctgaccgacttgaaaca
aaggctcgcgaacttacagatggggtccagcgagggtatcaaaaacggatgccaaagccg
gatacatga

DBGET integrated database retrieval system