KEGG   Haloquadratum walsbyi C23: Hqrw_1195Help
Entry
Hqrw_1195         CDS       T01942                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hwc  Haloquadratum walsbyi C23
Pathway
hwc00260  Glycine, serine and threonine metabolism
hwc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hwc01100  Metabolic pathways
hwc01110  Biosynthesis of secondary metabolites
hwc01130  Biosynthesis of antibiotics
hwc01230  Biosynthesis of amino acids
Module
hwc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hwc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hqrw_1195 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hqrw_1195 (trpB)
Enzymes [BR:hwc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Hqrw_1195 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CCC39162
UniProt: G0LGE2
Position
complement(218161..219408)
Genome map
AA seq 415 aa AA seqDB search
MTQRYADGKFGEYGGQYVPEALMPAIEELTDAYERYVLENEDGFMDEFRARLRDFGGRPT
PTEYAERLSERHGCDVYLKREDLLHGGAHKLNNALGQALLAKYMGKERIIAETGAGQHGT
ATAMAAAHLDMPCEVYMGERDINRQRPNVFRMRLNGSEVTPVTIGRGTLKEAISETMRDW
ATNVEDTHYIIGSIVGPHPFPSMVRDFHAVISEEARRQVREQTGGLPDAVLACAGGGSNT
MGTFAHFIDDTDVDLYAVEAGGSSLEVDEDAGVAPNSASLSTGDEGVLHGARTKLLQDSD
GQIMESHSVSSGLDYAGVGPELAHLVDTDRVNPVNVDDEATLAAFHRVSQLEGVIPALET
AHAFGYLEEQGSALGDSILINVSGRGDKDLEIAIEETAEHDIDIAPDMSEFAGGL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacgatacgcagacgggaaattcggtgaatatggcggacagtacgttccagag
gcattgatgcctgctattgaggaattaactgacgcgtatgagcgttacgtgttagagaat
gaagacggattcatggatgagttccgagcgcgacttcgggatttcggtggtcgaccaaca
ccaacggagtacgcagagcgtctatcagagcgacatggctgtgatgtatatttgaagcgc
gaagatcttctccacggtggtgcacacaaacttaataatgccctcggacaggcgttatta
gcgaaatatatgggtaaagagcgaattattgctgagaccggtgccggtcagcatggcaca
gcaactgcgatggcagccgctcatctcgatatgccctgtgaagtgtatatgggtgaacgc
gatattaatcgacagcgtccgaatgtattccgaatgcgactcaacgggtcagaggtaacg
cctgttacaatcggtcgtggaacactcaaagaagctatctctgaaacgatgcgtgattgg
gcaacaaacgtcgaagacacacattatattattggctcaattgtcggtccacatcccttc
ccgtcgatggttcgtgacttccacgcagttatttctgaggaggcacgacgacaggtgcgt
gaacagaccggtggacttcccgatgctgtgttggcatgtgctggtggagggtcaaacaca
atggggacatttgcacactttatcgatgatacggatgttgacctctatgctgttgaagca
ggcggatcaagtcttgaggttgacgaagacgctggtgttgcaccgaattcagcatcatta
tcaaccggcgatgagggcgttctgcacggtgcgcgaaccaagctactgcaggatagtgat
ggtcagattatggaaagccacagcgtctcttctgggcttgattatgctggtgttggtccg
gaactcgcacatcttgtcgatacggaccgtgtgaatccagtaaatgttgatgatgaagct
acacttgctgcatttcatcgagtctcacaactggagggcgttattccagcacttgagact
gcacatgcctttggatatcttgaagaacaggggagtgctctcggcgacagtatattaatt
aatgtttccggacgcggtgataaagatctggaaatagcgattgaggagaccgctgaacac
gacatcgatattgctcccgatatgtctgaattcgctggaggattgtga

DBGET integrated database retrieval system