KEGG   Haloquadratum walsbyi C23: Hqrw_1937
Entry
Hqrw_1937         CDS       T01942                                 

Definition
(GenBank) DUF814 domain protein
Organism
hwc  Haloquadratum walsbyi C23
SSDB
Motif
Pfam: FbpA NFACT-R_1 NFACT-R_2
Other DBs
NCBI-ProteinID: CCC39852
UniProt: G0LID2
Position
1002846..1005005
AA seq 719 aa
MDPKQELTSVDIAALVTELRRYTGAKVDKTYRYGDDLLRFRMRDFDRGRLELLIEVGTQK
RIHTADPDHVPDAPERPPNFAMMLRNRLSGADLVNVEQFEFDRIMILSFERGEEMTRIIV
ELFGDGNVAVVDSAGEVIQSLETVRLKSRTVAPGAQYEFPDSRVNPLQVTYDRFVSLMNE
SDTDIVRTLATQLNLGGLYAEEVCARAGIDKTTQITNTSDKIYRAIYTALESLGTQLQSG
DFEPRLYADDDAVIDATPFPLEERKQQNLDVTAYDSFNGALDVYFREVDRNPAAEESGQT
RPDFAAEIAKKQRIIEQQEGAIDDFEQRAEAERSRAELLYANYELVNEIIETIQTARAED
TSWDEIRETFAMGAERGIDAAAAVVSVDGAEAMVTIEIDDVRVPVNVDVGVEKNADQRYT
EAKRIEEKKEGALTAIENTREELNAVKQRRDAWDREDAKPDTEDNADNTETVTDKVNTGT
EPSRMGPTNDEWLSMTSIPLQKNDDWYEQFRWFHTSTGYLVVGGRNADQNETLVKKYLNK
HDRFFHTEAHGGPITILKASGPSEPAEPIELTAETRREVAQFAISYSSIWKEGRYADDAY
VVTPDQVSKTPESGEYIEKGSFVIRGDRTYIRDVAAEIAVGIQCADETQVIGGPPSAIAD
RVPTMVQVRPGRYAQNDAAKLAYREFRNRFADESFVRKIASPDKIQEFLPPGGSDLVDE
NT seq 2160 nt   +upstreamnt  +downstreamnt
atggacccgaagcaggaattaacaagcgttgatatcgctgctctcgtcaccgaattacgc
cgatacacgggtgcaaaagtcgataagacataccgatatggcgatgatctgcttcgattt
cggatgcgtgattttgatcgtggacgacttgaattattgattgaggtcggtacgcaaaag
cgtattcacactgctgatcctgatcatgtaccagatgcccctgagcgaccgccaaatttt
gcgatgatgcttcgaaatcgactgtcaggagcagatttggtaaacgttgaacagtttgaa
tttgaccgtattatgatcctcagcttcgaacgtggtgaggagatgactcgtattatcgtg
gagttattcggcgacggaaacgtcgctgttgttgattcggctggtgaagtcattcaaagc
ctggaaacagttcgattaaagtcgcgaactgttgcccctggagcacaatatgagttccca
gattcccgtgtgaatccactccaggttacatatgaccgatttgtcagtctgatgaatgag
tctgacaccgacattgttcgaacactcgcaacgcaattgaatctcggtgggctctatgct
gaggaagtgtgtgcacgagcgggcattgacaaaacaacgcaaattacgaatacctcagac
aaaatatatcgtgcaatttatactgcgcttgaatcgttggggactcaacttcaaagcggg
gattttgaaccacgattatacgccgatgacgatgctgtcattgatgccactccattccca
cttgaagaacggaaacaacaaaatctcgatgtaacagcatatgatagcttcaacggcgcg
ctggatgtctatttccgagaggtagaccgcaatccagccgcagaagaatcagggcagaca
cgtcctgactttgcggcagaaatcgcaaagaagcagcggattatcgaacaacaggagggg
gcaattgatgattttgaacagcgtgctgaggcagagcgatcccgcgcagagctattatac
gcgaattatgaacttgtcaatgaaataatcgaaacaattcagacagcaagagccgaagat
acctcatgggacgaaattcgtgaaacatttgcaatgggagccgagcgtggaatcgatgct
gctgcggctgttgtcagtgtcgacggtgctgaagcgatggtcacaatcgagattgatgac
gtgcgtgtgccagtcaatgttgatgttggcgttgagaagaatgctgatcagcgttacacg
gaagccaagcgaattgaggagaaaaaagagggtgcactcaccgccattgaaaacacgcgt
gaggaactcaatgcggtgaaacagcgtcgcgatgcatgggatcgtgaggatgcgaaacct
gatactgaagataatgccgataacacagaaactgttacagacaaagttaacactggcacc
gagccgagtcgcatgggtccgacaaatgatgaatggctctcaatgacatcaattccacta
caaaaaaatgatgattggtatgagcaattccggtggttccacacgtcgacaggatatctt
gttgtcggagggcgtaatgctgatcaaaacgagacgctcgtcaaaaaatatctcaataaa
catgatcgattcttccatacagaggcacatggtggacccatcacgattctcaaagcaagt
ggtccatcagagccggctgaaccgattgaactcacagcggagacgcgccgtgaagtcgcg
caatttgccatttcatattcatcaatctggaaggaaggacgttatgcagatgatgcatat
gtcgtcaccccagatcaggtttcaaaaaccccggagtcaggagagtatattgaaaaaggc
tcattcgtgattcgaggcgataggacatacattcgagatgtcgccgcggaaatagcagtt
ggaattcagtgcgcggatgaaacacaggtaatcggtggtcccccatcggcaattgcggat
cgagttccaacaatggtccaagtccgaccgggtcgttatgcgcagaatgatgccgcaaaa
ttagcctatcgcgagtttcgcaatcggtttgctgatgaatcgtttgttcgtaagattgca
agtccagacaaaatccaagagttcttaccacctggtgggagtgatcttgtcgatgaatag

DBGET integrated database retrieval system