KEGG   Haloquadratum walsbyi C23: Hqrw_2763Help
Entry
Hqrw_2763         CDS       T01942                                 

Gene name
folP
Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
hwc  Haloquadratum walsbyi C23
Pathway
hwc00790  Folate biosynthesis
hwc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hwc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Hqrw_2763 (folP)
Enzymes [BR:hwc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Hqrw_2763 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: CCC40587
UniProt: G0LJ19
Position
complement(1776493..1777701)
Genome map
AA seq 402 aa AA seqDB search
MRSVDAAGLSIGDESPPRIMGVLNISKESPYDPSVFDEPDAAATYVDSELIDEGADIVDI
GLESANKRFDVLSAEQELTRLETAIEAIESVSGDAVFSIETRYHEVADAALSRGFDMVND
ICGFADPKMPEVCSEYDVAVGKMASPPDLTRPGAIENVDDIYEALAQNGFTEKTIIDPAF
GGWSEEKTLADDRETFQRLREFRGLGRPILVSINRKNFLRSIADRSTEEALSVSLAATSL
AVERGAHVIRTHDVAETRDAALIGDAFTPDRPSHHLTTDDDSQVTAEELDVTTSAEAGRH
LDRLGISSMNDITDKSIIHTLEIDGLSRSAVTELSTVTAKSDSAIVTAVESESGREANLD
SDSQSSGIFLAGTPASLDAIATTVDDSVLTEILTSITQQISR
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgcgatcagtcgacgcggctggattgtcgattggtgatgagtctcctccacgaattatg
ggcgttctcaatatatctaaggagtcaccatatgacccaagtgtctttgatgaaccagat
gcagcagccacctacgttgatagcgaattgattgatgagggtgctgatattgttgatatc
ggtcttgagtctgcaaataagcgatttgacgtcctttctgctgagcaggaactcactcgg
cttgaaacggctattgaggcaatagaaagcgtttctggagatgccgtgttctcgatcgaa
acccgatatcatgaagttgcagatgcagctctttctcgaggctttgatatggtgaatgat
atctgtggattcgctgatccaaagatgccggaagtatgttcagagtatgatgtcgccgtt
ggaaagatggcatcacctcccgatctaacacgcccaggagcaattgagaatgtcgatgat
atctatgaagcgcttgcgcaaaatggcttcactgaaaaaactattattgatcctgccttt
ggaggatggtctgaagaaaagacacttgcagatgaccgtgagacgtttcaacggcttcgt
gagttccgcggacttggtcgacctattcttgtctctattaaccggaaaaactttctccga
tctatcgctgaccgctcaactgaagaggcactttcggtatcattagcggctacctcactc
gcagttgaacgtggtgcacacgttattcgaacgcatgatgttgcggaaacgcgcgacgcg
gcgttgattggagatgcattcacacccgaccgtccttcacatcatctcaccactgatgat
gactctcaggtcactgctgaagaactcgatgtgacgacatcagcggaagcgggtcgtcat
cttgatcgactcggtattagttctatgaatgatattacagataagtcaatcatccatact
ctcgaaattgatggcctctcacgatctgcggttaccgaactgagcactgttactgcaaag
tcagattcggctatcgtcactgcggttgaatccgaatctgggagagaagcgaacttagac
agcgattctcaatcatctggtatctttcttgccgggacgcctgcttcactggacgcaatc
gccactacagtcgatgactcggtattaacagagatactcacgagtatcacacaacagatc
agtcggtga

DBGET integrated database retrieval system