KEGG   Haloquadratum walsbyi C23: Hqrw_3101
Entry
Hqrw_3101         CDS       T01942                                 

Definition
(GenBank) sensor box histidine kinase
Organism
hwc  Haloquadratum walsbyi C23
SSDB
Motif
Pfam: HisKA_4TM PAS_9 PAS_4 PAS PAS_8 HATPase_c PT-TG
Other DBs
NCBI-ProteinID: CCC40888
UniProt: G0LJF4
Position
2126854..2128089
AA seq 411 aa
MSRESDQSSISAAENNHLSRITDPVFAINTDFEITYANPTMEAVFGSDRLTGRSLTDIVA
SGQENRLYIACETASKHQNPIQIQISSHALVDPDISSIAVTDIPDTAYHARIFPSETGVT
VYLFGYMNSTSTDTNAKINTSTSTSTSTTESSQQESSTGATHVRDHLVFMNQIIRHDLLN
GLNVISARADILSEFVESVGESHLETVNSRVNEMVTLLEVMQSITDIKLEDNTHSHSPQS
LQKAVQTAIDALDTRYRERITVSGSVPDVTVQADEHLSKVFSNLFASILRGEDGVSTAES
AITINAYTQNDPNRLEAPLQTDVHNNSVDHDQDDSIATTAVITITSSKGSISIKAQQHLT
ATDINNLASPDDGFGLYLVGRLIDSYDGSVLVNQESENEKTIITVVLLQTD
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgagtcgagaatctgatcaatcgtctatcagcgctgcagaaaataatcatctcagtcgt
attactgatccagtattcgcaatcaacaccgactttgagattacctatgcgaacccaacg
atggaggcggtattcggtagtgatagactcactggacggtcccttactgatatcgttgca
tccggtcaagagaatcgactatatattgcatgtgagactgcaagtaaacatcaaaaccca
atacagattcagatttcctctcatgctcttgttgatcctgatatttcttcaatcgctgtg
acagacatcccggacacagcatatcacgctcgcatcttcccgtctgagacaggcgtgaca
gtgtatctctttgggtatatgaattcaacaagcacggatacaaacgcgaagataaatacc
agtactagtaccagtacatctacgacggaatcttcacagcaagaatcatcaacaggtgcc
acacacgtgcgtgatcatcttgtatttatgaatcaaattattcggcatgaccttctcaac
ggactaaatgtgatcagtgcacgagcagatattctctctgaatttgttgagtcggttggt
gagtctcatcttgagactgttaacagtcgtgtcaatgaaatggttacattacttgaagtg
atgcagtcaataacagatatcaaacttgaggataatacccattctcactcaccacaatca
cttcagaaagctgttcaaacggcgattgatgcgctcgatacaagatatcgtgagcggatt
accgtttctggttcagtgccagatgtcactgtgcaagctgatgagcatctttcaaaggta
ttcagtaatctgtttgctagtatattaagaggagaagatggtgttagcaccgctgaatcg
gcaataacaatcaatgcatatacgcagaatgacccgaatcggctcgaagcaccattacaa
acggatgtacacaacaacagcgttgaccatgatcaagatgattcgattgcgacaacagca
gtaatcaccattacttcatcaaagggcagtatttcaataaaagcacagcaacatctcact
gcaacggatatcaataatcttgcatcccctgatgatggattcggtctgtatctcgttgga
agactgattgatagctatgatgggtccgtcctcgtcaatcaagagagtgaaaatgaaaaa
acgataattacggttgtgttgctacagacagattga

DBGET integrated database retrieval system