KEGG   Haloquadratum walsbyi C23: Hqrw_3359
Entry
Hqrw_3359         CDS       T01942                                 

Gene name
rps13
Definition
(GenBank) 30S ribosomal protein S13
  KO
K02952  small subunit ribosomal protein S13
Organism
hwc  Haloquadratum walsbyi C23
Pathway
hwc03010  Ribosome
Brite
KEGG Orthology (KO) [BR:hwc00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Hqrw_3359 (rps13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hwc03011]
    Hqrw_3359 (rps13)
Ribosome [BR:hwc03011]
 Ribosomal proteins
  Bacteria
   Small subunit
    Hqrw_3359 (rps13)
  Archaea
    Hqrw_3359 (rps13)
SSDB
Motif
Pfam: Ribosomal_S13 HHH_5
Other DBs
NCBI-ProteinID: CCC41130
UniProt: G0LM10
Position
complement(2359453..2359974)
AA seq 173 aa
MSANNTQDDAAEEEDDDLQYFVRIGTTDLDGTKAVERSLTDMKGIGKRTARIITDVASVD
RHATFGLLEEDEIDSITDAVENLDDHIPGWMTNRREDFFSGDTDHKTGADLEEKRRHDVN
RMKMIDSYKGVRHKRGQKVRGQRTKSTGRTEGTIGVNVEAIKEEAAEAAEEEE
NT seq 522 nt   +upstreamnt  +downstreamnt
atgagtgcaaataatacacaagacgacgccgccgaggaggaagatgatgacctccaatat
ttcgtccgaatcgggacgacagatctcgatgggacgaaagcggttgagcggagtctcacg
gacatgaaaggtattggaaagcgtaccgcacgcattattaccgacgtggcatccgtcgac
cggcatgcaacgtttggtcttcttgaagaggacgagatcgactcaatcaccgatgctgtg
gaaaacctcgacgaccacatccctggatggatgacaaaccgtcgtgaggatttcttcagc
ggtgataccgatcacaaaactggagcagatctcgaagaaaagcgccgccacgacgttaac
cggatgaaaatgattgattcatacaaaggtgtccgacacaagcgtggtcagaaagtccgt
ggtcagcgcacaaagtccacagggcgtactgagggaacgattggcgtgaatgtcgaagca
atcaaagaagaagccgccgaggctgcggaagaagaggagtaa

DBGET integrated database retrieval system