KEGG   Haloquadratum walsbyi C23: Hqrw_3884Help
Entry
Hqrw_3884         CDS       T01942                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hwc  Haloquadratum walsbyi C23
Pathway
hwc00010  Glycolysis / Gluconeogenesis
hwc00051  Fructose and mannose metabolism
hwc00562  Inositol phosphate metabolism
hwc01100  Metabolic pathways
hwc01110  Biosynthesis of secondary metabolites
hwc01120  Microbial metabolism in diverse environments
hwc01130  Biosynthesis of antibiotics
hwc01200  Carbon metabolism
hwc01230  Biosynthesis of amino acids
Module
hwc_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hwc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hqrw_3884 (tpiA)
   00051 Fructose and mannose metabolism
    Hqrw_3884 (tpiA)
   00562 Inositol phosphate metabolism
    Hqrw_3884 (tpiA)
Enzymes [BR:hwc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Hqrw_3884 (tpiA)
Exosome [BR:hwc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Hqrw_3884 (tpiA)
  Exosomal proteins of bladder cancer cells
   Hqrw_3884 (tpiA)
  Exosomal proteins of melanoma cells
   Hqrw_3884 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG Hydrolase_like FMN_dh
Motif
Other DBs
NCBI-ProteinID: CCC41617
UniProt: G0LF54
Position
complement(2875253..2875897)
Genome map
AA seq 214 aa AA seqDB search
MFILINLKAYPCDPLEIANAARDVADDSGVRVAVSPQAADIARVSDTGVETWAQHVSPNN
YGSYTGSTLAEAVANAGATGTLINHSERRLTLADIDTAVNAASRVDLDTCVCANNPAQIG
AVTALSPDSVAVEPPALIGGDASVATADPDIVSNAVESTNSIDKTVDVYCGAGISAGNDV
IAARDLGASGILLASGVAKADNPRKALEDLVAPI
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgtttatcttaatcaatctcaaggcatacccgtgtgacccactcgaaatcgcgaacgca
gctcgagatgttgctgatgattccggagttcgtgttgccgtatcaccacaggcagccgat
attgcgcgtgtctcggataccggtgtcgagacatgggcacagcatgttagcccaaataac
tacgggagttacactggtagtacacttgcggaggctgttgcaaacgccggagcaactgga
acactaatcaatcactccgagcggcgactcacacttgctgatattgatacagccgtcaac
gcagcatcgcgtgttgatcttgatacgtgcgtctgtgcgaacaacccagcacagattggg
gcagtgacagcacttagtccagacagcgtcgctgttgaaccaccagcgctcattggtgga
gatgcatccgttgcaacagctgatccggatattgtctccaatgctgttgagtcaacaaat
agtattgataaaacagttgatgtctactgtggagccggaatatctgctggtaatgatgtt
atcgctgctcgtgatctcggtgcaagtggtattctgcttgcatctggggttgcaaaggca
gataatcctcgaaaagcacttgaagacctcgtagctcccatataa

DBGET integrated database retrieval system