KEGG   Haloquadratum walsbyi C23: Hqrw_3932Help
Entry
Hqrw_3932         CDS       T01942                                 

Gene name
psd
Definition
(GenBank) probable archaetidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
hwc  Haloquadratum walsbyi C23
Pathway
hwc00564  Glycerophospholipid metabolism
hwc01100  Metabolic pathways
hwc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hwc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Hqrw_3932 (psd)
Enzymes [BR:hwc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     Hqrw_3932 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: CCC41665
UniProt: G0LFA2
Position
2926104..2926736
Genome map
AA seq 210 aa AA seqDB search
MLILSVLSNRFAPGVRRYAIPVFIFAGVIGVIIPPVGAVALLIGGAILWFFRDPSRQPSG
PGIVAPAEGRITVIREEGEQIRIGIFLNVTDVHVARAPIDGEVTQCTHREGAHRPAFMKD
STRNERVDIAVTTSDGPAEISLIAGAVARRIHPYIDNGMSIDRAQRIGHIDFGSRVDVVL
PPGYTADDLLITDGQKVRAGESIVARKNNQ
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
gtgttaattttatcagtactctcgaatcgatttgcccctggtgttcgtcgatatgccatt
ccagtattcatatttgcgggtgtaattggtgtcattatcccacctgttggtgcagtcgca
ttactgattggtggtgccattttatggtttttccgtgatccatctcgacaaccctctggt
ccgggtattgtggctcccgccgagggtcgtataactgttattcgagaggaaggcgagcag
attcgaattggtattttcttgaatgtgaccgatgtccacgttgcacgcgcaccaatcgat
ggagaggttacacagtgcacgcatcgggagggggctcaccgtccagcattcatgaaagac
tcaacaagaaatgagcgcgttgatattgcagtcacgacctcagatggacccgctgaaata
tcacttattgctggtgctgttgcacgacggatccatccatatattgataatggaatgtca
atcgatcgcgcacagcggattggacacatcgattttggatcacgtgttgacgtggtactc
ccgccaggatatactgctgatgatcttcttattacagatggtcagaaagtgcgtgcaggt
gaatcaattgttgcacgaaaaaacaatcaataa

DBGET integrated database retrieval system