KEGG   Halopiger xanaduensis: Halxa_0608Help
Entry
Halxa_0608        CDS       T01532                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
hxa  Halopiger xanaduensis
Pathway
hxa00030  Pentose phosphate pathway
hxa01100  Metabolic pathways
hxa01120  Microbial metabolism in diverse environments
hxa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hxa00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Halxa_0608
Enzymes [BR:hxa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Halxa_0608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AEH39197
UniProt: F8DDU3
Position
pHALXA01:352476..354146
Genome map
AA seq 556 aa AA seqDB search
MLHSRGPLLTIDVGAETTDETDIESVHREYIGGRGVATRLAHERIPFDVGPFAPDNRLFF
TTGPMQASRMSFTGRMNCTGVSPLTDGLLSSNAGGFMSRNFAATGYGAVEIAGASDELVV
VHVRDDGVRFESVPDLEDATVPETVAYLEDERGITADQTAVIGPAGEREVRFASIMTSEE
RAFGRGGLGAVLGSKNVKAITFDGDSAPDIEIPATQNEIHSEAATDDNIMKRQGTVAVMD
LANEIEGLPSYYFSERQFEGVEGINGAAVEEKKYKKGTCSACAFACKLPTKDDERGVETE
GPEFEVAMAFGSNSGVDDIVDVMKSNELCDRYGLDAISAGNTVAAYLAAEDEFGNDDLIH
ELVERIAFRDGVGDTLAEGIDRAHEELGVDNWTVKGMDFAAHEGRVLHGQGLSYAVANRG
ADHMYSVFYSVEYPLVPDEQALDPTGTVGKADRLVQRENLMALNDSGVVCKFSRDYMNPD
RYESLFSADFEELLAVGDRVVTLERHFNNQRGFDASDDDLPYEIPDFERALEEYYDARGW
EDGVVPDDAVPAGVSV
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgctacacagtcgcgggcccttactgacgatcgacgtgggggcggagacgacggacgaa
acggatatcgaatcggtccaccgggagtacatcggcggccgcggcgtcgcgacgcggctc
gcccacgaacggattccgttcgacgtcgggccgttcgccccggacaaccgactgttcttc
accaccggcccgatgcaggcctcgagaatgagcttcacggggcggatgaactgcaccggc
gtctcgccgctgaccgacgggctcctctcgagcaacgccggcggcttcatgtcccgaaac
ttcgccgccaccggctacggcgccgtcgagatcgcgggtgcgagcgacgagctggtcgtc
gtccacgtccgcgacgacggcgtcaggttcgagtccgtcccggacctcgaggacgcgacc
gttcccgagacggttgcgtatctcgaggacgaacgcgggatcacggcggatcagaccgcc
gtcatcgggccggccggcgaacgcgaagttcggttcgcgtcgattatgacctccgaggag
cgggcgttcggccgcggcggactgggcgcggtgctcggttcgaagaacgtcaaggcgatc
accttcgacggcgattccgcccccgacatcgagattcccgcgacgcaaaacgagatccac
agcgaagcggcgaccgacgataacatcatgaagcgccaggggaccgtcgcggtgatggac
ctggcgaacgagatcgagggcctgccgtcgtactacttctccgagcggcagttcgagggt
gtcgaggggatcaacggcgcggccgtcgaggagaagaagtacaagaaaggtacctgctcc
gcctgcgccttcgcctgtaagcttccgaccaaagacgacgaacgcggcgtcgaaaccgaa
gggccggagttcgaggtcgcgatggccttcggctccaactccggcgtcgacgacatcgtc
gacgtgatgaagtcgaacgaactctgcgatcggtacggtctcgacgcgatctccgccggg
aacaccgtcgcggcgtacctcgccgccgaggacgagttcggcaacgacgacctgatccac
gagctcgtcgaacggatcgcgttccgggacggcgtcggcgacaccctcgcggaggggatc
gaccgcgcccacgaggaactcggcgtcgacaactggacggtcaaggggatggacttcgcc
gcccacgaggggcgcgtccttcacggtcagggcctctcttacgcggtcgccaaccgcggc
gccgaccacatgtactcggtcttctactcggtcgaatacccgctcgtccccgacgagcag
gccctcgacccgaccggcaccgtcggcaaggccgaccgactcgtccaacgggagaacctg
atggcgctcaacgactccggcgtcgtctgcaagttctcgcgggactacatgaatcccgac
cggtacgagagcctgttcagcgccgacttcgaggagttgctcgcggtcggcgatcgggtc
gtcacgctcgagcgtcacttcaacaaccagcgcgggttcgacgcgtcggacgacgacctg
ccctacgaaatccccgatttcgagcgggcgctcgaggagtactacgacgctcgcggctgg
gaggacggcgtcgttcccgacgacgcagttcctgcgggcgtctccgtgtaa

DBGET integrated database retrieval system