KEGG   Halopiger xanaduensis: Halxa_0852Help
Entry
Halxa_0852        CDS       T01532                                 

Definition
(GenBank) Formaldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
hxa  Halopiger xanaduensis
Pathway
hxa00625  Chloroalkane and chloroalkene degradation
hxa00680  Methane metabolism
hxa01100  Metabolic pathways
hxa01120  Microbial metabolism in diverse environments
hxa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hxa00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Halxa_0852
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Halxa_0852
Enzymes [BR:hxa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     Halxa_0852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_assoc Glu_dehyd_C HI0933_like AlaDh_PNT_C Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AEH35491
UniProt: F8D7P3
Position
159120..160286
Genome map
AA seq 388 aa AA seqDB search
MSMDAVVYQGPNDVAIEEVDEPEIEHENDIIVDITTTAICGSDLHMYEGRTSADPGIVFG
HENMGTVIETGDAVTSLEEGDRVVMPFNVACGFCRNCENGYTGFCTNVNPGFAGGAYGYV
AMGPYKGGQAEKLRVPFADFNALKLPEGNEHEDSFVLLADIFPTGWHGTRLANLQPGESI
AVFGAGPVGLMAAYSAKLQGASEIYVVDRVESRLELAEDHCDARAINFEERDPVEQIKDL
HGGGVDNGVDAVGYQAIDPETDPTDDAYDPARENPAIVLNQLIQTVRPTGELGVPGLYVP
SDPGAPDEMAAQGRLGIDFGKLFEKGLKVGTGQCNVKEYNRELRDMIIEGRADPSWVVSH
RVDLDQAPEMYEKFDEREEGVTKVLLEP
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatggatgccgtcgtttatcaaggaccgaacgatgtagcgatcgaagaagtcgac
gaacccgaaatcgaacacgagaacgatatcatcgtcgatatcacgaccacggcgatctgc
ggctcggatctccacatgtacgagggtcggacctcggccgatccggggatcgtcttcggg
cacgaaaacatggggaccgtcatcgaaaccggcgacgccgtcacctcgctcgaggagggc
gaccgcgtcgtgatgccgttcaacgtcgcctgcggcttctgccgaaactgcgagaacggc
tataccggcttctgtaccaacgtcaaccccggcttcgcgggcggcgcgtacggctacgtc
gcgatggggccgtacaagggcgggcaggccgagaaactccgcgttccgttcgccgatttc
aacgcgctgaaactcccggaggggaacgaacacgaggactccttcgtgctcctcgcggac
atcttcccgacggggtggcacgggacccgactcgcgaacctccagcccggcgagtcgatc
gcggtcttcggcgccggtcccgtcggtctgatggccgcctacagcgccaagctacagggc
gcctcggagatctacgtcgtcgaccgcgtggagagtcgcctcgagttggccgaggatcac
tgcgacgctcgcgcgatcaacttcgaggagcgcgatccggtcgagcagatcaaagaccta
cacggcgggggcgtcgacaacggcgtcgacgccgtgggctatcaggcgatcgatcccgag
accgatccgaccgacgacgcctacgatccggcgcgggagaacccagcgatcgtgctcaac
cagttgatccagaccgttcggccgaccggcgaactcggcgttccggggctgtacgtcccg
tcggaccccggcgcgcccgacgagatggccgcccagggccgcctcggcatcgacttcggg
aaactcttcgagaaggggctgaaggtcggtaccggccagtgtaacgtcaaggagtacaac
cgagagctgcgcgacatgatcatcgagggacgggcagatcccagttgggtcgtctcccac
cgcgtcgatctcgaccaggcgccggagatgtacgagaagttcgacgagcgcgaggagggc
gtcaccaaggttctgctcgagccctaa

DBGET integrated database retrieval system