KEGG   Halopiger xanaduensis: Halxa_1362Help
Entry
Halxa_1362        CDS       T01532                                 

Definition
(GenBank) Threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
hxa  Halopiger xanaduensis
Pathway
hxa00260  Glycine, serine and threonine metabolism
hxa01100  Metabolic pathways
hxa01110  Biosynthesis of secondary metabolites
hxa01120  Microbial metabolism in diverse environments
hxa01130  Biosynthesis of antibiotics
hxa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hxa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Halxa_1362
Enzymes [BR:hxa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Halxa_1362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AEH35995
UniProt: F8DC15
Position
670759..671772
Genome map
AA seq 337 aa AA seqDB search
MIDLRSDTVTTPDDDMRNAAATADVGDDVYGEDPTVNELETRAAEAVGKEAALYVPSGTM
GNQIAARVHTDRGQEVLADRKSHVVKYELGGFAQHADLQVRMLETDRGVPTPEQVDEATV
AEDLHRPGTGLLCLENTHNARGGLAIDPEKIAAAADAARERDVPVHLDGARVFNAATALD
VPVSDIVDPVDSVMFCLSKGLGAPIGSMLAGSEEFVEEARRTRKLFGGGMRQAGIVAGPG
LEALENVDDLAADHENARLLADGLSELEGFDVQEPETNIVLADVSETGLDGEAVLERCRE
RDVLATAFGPTTVRFCTHRDVDRENVERALERLVAEF
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatctccgctcggacaccgtcacgacgcccgacgacgacatgcgcaacgccgcg
gctaccgccgacgtcggcgacgacgtctacggcgaggacccgaccgtcaacgaactcgag
acgcgcgcggccgaggccgtcggcaaagaagcggccctctacgtcccctccgggacgatg
ggcaaccagatcgcagcgcgagtccacaccgatcgcggacaggaggtgctggccgaccgc
aagagccacgtcgtcaagtacgaactcggcggcttcgcccagcacgccgacctccaagtc
cgcatgctcgagaccgaccgcggcgtgccgacgcccgagcaggtcgacgaggccaccgtt
gcagaggacctccatcgacccggcaccggcctcctctgcctcgaaaacacgcacaacgcc
cgcggcggactcgcgatcgaccccgagaagatcgccgccgcggccgacgcggcccgcgaa
cgcgacgtgccggttcacctcgacggcgcgcgcgtgttcaacgccgcgacggcgctggac
gtccccgtcagcgacatcgtcgaccccgtcgactccgtcatgttctgcctctcgaagggg
ctcggcgcgccgatcggctcgatgctcgccgggagcgaggagttcgtcgaagaagcccgg
cgcacccgcaagctgttcggcggcggcatgcgccaggccggaatcgtcgccggtcccggc
ctcgaagccctggagaacgtcgacgacctcgcggcggatcacgagaacgcgcggctgctc
gccgacggcctgagcgagttggaggggttcgacgtgcaggagccggagacgaacatcgtt
ctcgcggacgtctcggagacgggactggacggtgaggcggtgctcgagcgctgccgcgag
cgggacgtgctggcgacggccttcgggccgacgacggttcggttctgcacccaccgcgac
gtcgaccgcgagaacgtcgaacgggcgctcgagcggctcgtagccgagttttaa

DBGET integrated database retrieval system