KEGG   Halopiger xanaduensis: Halxa_1788Help
Entry
Halxa_1788        CDS       T01532                                 

Definition
(GenBank) molybdenum cofactor synthesis domain protein
  KO
K03638  molybdopterin adenylyltransferase [EC:2.7.7.75]
Organism
hxa  Halopiger xanaduensis
Pathway
hxa00790  Folate biosynthesis
hxa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hxa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Halxa_1788
Enzymes [BR:hxa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.75  molybdopterin adenylyltransferase
     Halxa_1788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MoCF_biosynth
Motif
Other DBs
NCBI-ProteinID: AEH36416
UniProt: F8D564
Position
1101801..1102391
Genome map
AA seq 196 aa AA seqDB search
MTVDQDDRRSTDDHGHDVIDPLCVGIVTVSSSRAQADEADPDDPGGDTIRECFEDEGHEV
QERVLVRDDYSAIRTAVRGLVARRDIDVVLTTGGTGVTADDVSPEATSSLFERELPGFGE
LFRSLSWEEVGTRAMASRATAGIAVDTPVFCLPGSKSACRTACEELIVPEAPHLAGLATR
HRKDTTDRSLSAYGDE
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgacagtcgatcaggacgacaggcggagtaccgacgatcacggccacgacgtcatcgat
ccgctctgcgtcgggatcgtgacggtctcgagttcgcgcgcgcaggcggacgaagcagac
ccggacgatccgggcggcgacacgattcgggagtgtttcgaggacgagggccacgaagta
caggagcgcgtgctcgtccgcgacgactactcggcgatccggacggccgtgcgcggcctc
gtcgcgcgccgggatatcgacgtcgtactcacgaccggcgggactggcgtcaccgccgac
gacgtctcgccggaggcgacctcgtcgctgttcgagcgcgaactgccaggcttcggcgaa
ctcttccgctcgctctcgtgggaggaggtcggcacccgcgcgatggcctcgcgcgcgacg
gccggcatcgcggtcgatacgcctgtcttctgcctgccggggagcaagagcgcctgccga
accgcctgcgaggaactgatcgtccccgaggcgccccacctcgcggggctggccacgcgc
caccggaaggatacgaccgaccggtcgctgtcggcctacggcgacgagtaa

DBGET integrated database retrieval system