KEGG   Halopiger xanaduensis: Halxa_2900
Entry
Halxa_2900        CDS       T01532                                 

Definition
(GenBank) hypothetical protein
Organism
hxa  Halopiger xanaduensis
SSDB
Motif
Pfam: DUF5798 HAP1_N DUF1465 BLOC1_2 AAA_13 Arfaptin DUF1664 PspB DUF16 NPV_P10 Herpes_UL6 DUF4988 CCDC85 Tho2 Spc24 DivIC
Other DBs
NCBI-ProteinID: AEH37516
UniProt: F8D4P7
Position
2227044..2227373
AA seq 109 aa
MGLGSTAKKIQGLSERAEAMYKQVQKLQERIISLEEEMDDTHDTVNRIDHQLTEQRALLL
AIAEEQGIDGEEILAQAAIDEAELEDADDESEATDGESASADGGETTAE
NT seq 330 nt   +upstreamnt  +downstreamnt
atgggactcggcagcactgcaaagaagattcagggcctctcggaacgggccgaggcgatg
tacaaacaggtacagaagctccaggagcggatcatcagcctggaagaggagatggacgac
acccacgatacggtcaaccggatcgaccaccagttgaccgagcagcgcgcactcctgctg
gctatcgcggaggagcaggggatcgacggcgaggagatcctcgctcaggcggcgatcgac
gaggccgaactcgaggatgcggacgacgagtccgaggcgaccgacggcgagtctgcatcg
gcagacggcggcgagacgaccgccgagtaa

DBGET integrated database retrieval system