KEGG   Halopiger xanaduensis: Halxa_4024Help
Entry
Halxa_4024        CDS       T01532                                 

Definition
(GenBank) Nicotinamide-nucleotide adenylyltransferase
  KO
K00952  nicotinamide-nucleotide adenylyltransferase [EC:2.7.7.1]
Organism
hxa  Halopiger xanaduensis
Pathway
hxa00760  Nicotinate and nicotinamide metabolism
hxa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hxa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Halxa_4024
Enzymes [BR:hxa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     Halxa_4024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like Citrate_ly_lig HIGH_NTase1
Motif
Other DBs
NCBI-ProteinID: AEH38629
UniProt: F8D3W7
Position
complement(3378777..3379295)
Genome map
AA seq 172 aa AA seqDB search
MTRGFYIGRFQPFHNGHLSMVEQIADEVDELVLGIGSADDSHSVRNPFTAGERIMMITKS
LVDYDLVTYAVPIEDLDRNSVWVSHVQSMSPDFDVAYSNNPLVIQLFREAGIEIRQSPMF
NREVLEGSEVRQRMIDDGDWESLVPEAVVGVVEEIDGIERIQMVSKTDSNGN
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcgggttctacatcggacgcttccagccgttccacaacggccacctgagcatg
gtcgaacagatcgccgacgaggtggacgaactcgtcctcggcatcggaagcgccgacgac
tcccactccgtccggaatccgttcaccgccggcgagcggatcatgatgatcacgaagtcg
ctcgtcgactacgacctcgtgacctacgccgtcccgatcgaggacctcgaccgcaactcg
gtgtgggtgagccacgtccagagcatgagccccgacttcgacgtcgcctactcgaacaac
ccgctcgtcatccagctgttccgggaggccggcatcgagatccgccagtcgccgatgttc
aaccgcgaggtgctcgagggcagcgaggtccgccagcggatgatcgacgacggggactgg
gagtcgctcgtccccgaggctgtcgtcggcgtcgtcgaggagatcgacgggatcgagcgg
atacagatggtcagtaagacggactcgaacggcaactga

DBGET integrated database retrieval system