KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_0041Help
Entry
HY04AAS1_0041     CDS       T00745                                 

Definition
(GenBank) thiamine pyrophosphate protein domain protein TPP-binding
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Pathway
hya00010  Glycolysis / Gluconeogenesis
hya00020  Citrate cycle (TCA cycle)
hya00620  Pyruvate metabolism
hya00633  Nitrotoluene degradation
hya00640  Propanoate metabolism
hya00650  Butanoate metabolism
hya00680  Methane metabolism
hya00720  Carbon fixation pathways in prokaryotes
hya01100  Metabolic pathways
hya01120  Microbial metabolism in diverse environments
hya01130  Biosynthesis of antibiotics
hya01200  Carbon metabolism
Module
hya_M00173  Reductive citrate cycle (Arnon-Buchanan cycle)
hya_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hya00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HY04AAS1_0041
   00020 Citrate cycle (TCA cycle)
    HY04AAS1_0041
   00620 Pyruvate metabolism
    HY04AAS1_0041
   00640 Propanoate metabolism
    HY04AAS1_0041
   00650 Butanoate metabolism
    HY04AAS1_0041
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    HY04AAS1_0041
   00680 Methane metabolism
    HY04AAS1_0041
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HY04AAS1_0041
Enzymes [BR:hya01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HY04AAS1_0041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: ACG56733
UniProt: B4U663
Position
complement(36303..37169)
Genome map
AA seq 288 aa AA seqDB search
MGLEYVQISPGFEKYMPKDYVDLVKYGQFGKQIDVQQIDQIKELVEEHPMCAGCYMAYFV
RIFYAALPKPEDTIVLGTAGCARLALSQAAVPFIYGNYGDTNAVASGLKRALNIRFPDKV
KDVVVIAGDGGLMDIGFSMTMHSWFRRENFTTIMVDNEVYGNTGGQESGMSPKGVQLKMA
PKGKKFDKINAVELAKTAGCVYVAKLAPTNPKRIAKTIKRAILAARELGPTFIHVYTSCN
IEYSIPTERVLADAKEREKNDFGFYEWMTDEAKEYLEEQEKKMAEVKA
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgggcttagaatacgttcaaatatcacctggatttgagaaatatatgccaaaggactat
gtagaccttgttaaatatggtcagtttggcaaacaaattgatgtacaacagatagatcaa
ataaaagagttggtcgaagagcatccaatgtgcgcaggatgctatatggcctactttgtg
agaatattctatgcagctttaccaaaaccagaagacactatagtgcttggtaccgctggg
tgtgctagattggcgctttcccaagctgctgtacccttcatctatggaaactacggagat
acaaacgctgttgcatctggattaaaacgcgctcttaacataagatttccggacaaggta
aaggacgttgtggttatagccggtgatggtggactaatggatataggttttagcatgaca
atgcactcttggtttagaagagaaaactttaccactataatggttgataacgaggtttac
ggtaacaccggtggtcaagagagcggtatgtcacctaaaggagtacaactcaaaatggcc
cctaaaggtaagaagtttgacaaaataaatgcagttgaattagcaaaaaccgcaggttgt
gtttatgtagcaaagctagcacccacaaatcctaagagaatagccaaaaccatcaaaagg
gcaatactagcagctagggagctagggcctacctttatacacgtttatacctcatgcaat
atagaatattcaatacctaccgaaagagtgctagcggatgcaaaagaaagagaaaaaaac
gattttggcttttacgaatggatgacagatgaagccaaagagtatttagaagagcaagaa
aagaaaatggcagaggttaaagcttaa

DBGET integrated database retrieval system