KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_0065
Entry
HY04AAS1_0065     CDS       T00745                                 

Definition
(GenBank) ketol-acid reductoisomerase
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Pathway
hya00290  Valine, leucine and isoleucine biosynthesis
hya00770  Pantothenate and CoA biosynthesis
hya01100  Metabolic pathways
hya01110  Biosynthesis of secondary metabolites
hya01210  2-Oxocarboxylic acid metabolism
hya01230  Biosynthesis of amino acids
Module
hya_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:hya00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    HY04AAS1_0065
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    HY04AAS1_0065
Enzymes [BR:hya01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     HY04AAS1_0065
SSDB
Motif
Pfam: IlvN IlvC AdoHcyase_NAD 2-Hacid_dh_C F420_oxidored NAD_binding_2 GFO_IDH_MocA CoA_binding CoA_binding_2 PDH ApbA NAD_binding_7
Other DBs
NCBI-ProteinID: ACG56757
UniProt: B4U6I9
Position
61362..62363
AA seq 333 aa
MAKIYYDEDASLGILAMKTVAIVGYGSQGHAHALNLRDSGIRVIVALDDKSPHRKTAMED
GFSVYTTSRATQEADVIMILTPDTVQPAVYKECIEPNLTPGKAIAFAHGFNIHFGQIVPP
KDIDVFMVAPKGPGHLVRWMYEEGKGVPALISIHQDATGSCRDIALAYAKGIGATRAGVI
ETTFREETETDLFGEQAVLCGGATALIKAGFETLVEAGYQPEMAYFECLHELKLIVDLIY
QHGIAGMRYSISDTAKYGDVTRGDRVYEAVKPLMKQMLKEIQDGEFAREWILENQANRPV
YNALLNKDKEHLVEKVGKELRQMMPWLSGKELK
NT seq 1002 nt   +upstreamnt  +downstreamnt
atggcgaaaatttactacgacgaagatgcatctttgggtatcttggctatgaaaactgta
gccatagtgggttatggttctcaaggacacgctcatgctttaaatctaagagacagtggt
attagggttatagtggctttagacgataaaagtcctcatagaaaaactgctatggaagat
ggttttagcgtatataccacctctagagcaactcaagaggccgatgtgataatgatatta
acaccagacacggttcaaccagctgtatataaagaatgcatagaacctaatttaacacct
ggaaaagctatagcctttgcccatggttttaacatacattttggtcaaatagtgccacca
aaagatatagatgtatttatggtggctccaaaaggaccaggccatttggtaagatggatg
tacgaagagggaaaaggagtaccagctcttatatctatacatcaagatgctacaggttct
tgtagagatatagccttagcttatgcaaaaggcataggtgctacaagggctggggttata
gaaaccacgtttagagaagaaacggaaacagacttatttggtgagcaagcggtgctttgt
ggtggtgctacagcccttataaaagctggttttgaaacgcttgtagaggccggttatcaa
ccagagatggcttattttgaatgtcttcatgagttaaagctaatagtagacctcatatac
caacacggcatagctggtatgagatattctatatcagataccgcaaaatatggcgatgta
acaagaggtgatagagtatacgaagctgtcaaacctcttatgaaacagatgctcaaagaa
attcaagatggtgagtttgccagagaatggatattggaaaatcaagccaacagaccagtt
tacaacgctcttttaaataaggataaagaacatttggtggaaaaagttggtaaagagcta
agacagatgatgccgtggctatctggtaaagagttaaaatga

DBGET integrated database retrieval system