KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_0089Help
Entry
HY04AAS1_0089     CDS       T00745                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Pathway
hya00010  Glycolysis / Gluconeogenesis
hya00620  Pyruvate metabolism
hya00640  Propanoate metabolism
hya00680  Methane metabolism
hya00720  Carbon fixation pathways in prokaryotes
hya01100  Metabolic pathways
hya01110  Biosynthesis of secondary metabolites
hya01120  Microbial metabolism in diverse environments
hya01130  Biosynthesis of antibiotics
hya01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hya00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HY04AAS1_0089
   00620 Pyruvate metabolism
    HY04AAS1_0089
   00640 Propanoate metabolism
    HY04AAS1_0089
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    HY04AAS1_0089
   00680 Methane metabolism
    HY04AAS1_0089
Enzymes [BR:hya01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     HY04AAS1_0089
Lipid biosynthesis proteins [BR:hya01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   HY04AAS1_0089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACG56781
UniProt: B4U6L3
Position
82156..84036
Genome map
AA seq 626 aa AA seqDB search
MNDEVLLKVEEKINPPSRILEEAHIKDYESIYKKSIENPDAFWAEAAQDITWFKPFSKVL
EWNFPYAKWFLDGKLNASYNCLDRHIEEGLRNKVAYIGVNEDLEEKKITYGELLELVNRL
ANALKSLGLKKGDRVSIYMPNTVEAVASMLACARIGLIHQVVFAGFSEGALRTRVEDAGA
SAIITATYTKRRGKKVELLPTALEAIKGLDSIKHVICWDRDNAGLPEGVLGFYDIVKSQK
PECEPEHMDSEDPLFILYTSGTTGKPKGVIHTTGGYMVNVHFTTKNVFALKPNDIYWCTA
DIGWITGHSYIVYGPLSVGVTSVIFEGAPDYKDPSTWWKIVEKYRVNKFYTAPTAVRLFM
KYGEQWPEAHDLSSLKILGSVGEPINPEAWHWYYEHIGHKNCAIVDTWWQTETGTHMITT
LPGNPMKPGKAGKPLPGIEVAIVDKNGNPVPPNTVGYVVIKNPWPSMMRNCWGQPERYKK
YWTEIPGNVYNADDLGSIDEEGDIMIVGRADDVLSVAGHRIGTMEVESAIVDHEAVAEAA
VIGKPDPIKGERIKAFVILKQDYNPSEELKKSIQEHVKHVLGAIAYPEEIEFVDKLPKTR
SGKIMRRVLKAKELGLDIGDVSTLED
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatgaagtgcttttaaaagtggaggagaagataaacccaccatctcgcatattg
gaggaggctcatataaaggattatgagtctatttacaaaaaatcaatagaaaatccagat
gctttttgggcagaagcagcacaagatattacatggtttaaaccattttcaaaggtttta
gaatggaactttccatacgccaaatggtttttagatggtaaattaaacgcctcttacaac
tgtcttgataggcatatagaagaaggccttagaaacaaagtagcttatataggagtaaac
gaagatttagaagagaaaaaaattacctacggggagcttcttgagcttgtaaatagactt
gcaaatgctttgaaaagcttaggccttaaaaaaggcgatagagtttctatatacatgcca
aacacggtagaagctgtggcaagcatgctggcttgcgctcgtattgggcttatacatcaa
gtagtgtttgccgggtttagtgaaggcgctttaagaacgagggtagaggatgcaggggca
agcgctataataactgccacatacacaaaaaggcgtggtaaaaaagtagagcttttgcct
actgctttagaagctataaaaggccttgattcaatcaaacatgtaatatgttgggataga
gataacgctggtcttccagagggagtgctcggcttttacgatattgttaaaagccaaaaa
ccagaatgtgaaccagaacatatggattctgaagatccactttttatactctatacttct
ggtaccaccggtaagcctaaaggtgtgatacataccaccggtggatacatggtaaatgtg
cattttaccacaaaaaacgtatttgccctaaagccaaacgatatatactggtgtactgct
gatataggctggataacagggcattcttacatagtttatgggccgttgtctgtaggtgtt
acaagcgttatatttgagggcgctccagactataaagatccatccacttggtggaagata
gtagaaaaatacagagtaaacaagttttatactgctccaacagctgttagactttttatg
aaatacggagagcaatggccagaagctcatgatctatcttctcttaaaatccttggttct
gtgggcgaacctataaatcctgaagcttggcactggtactacgagcatataggacataaa
aattgcgccatagtagatacttggtggcaaacagagactggaactcacatgataactact
ttgcctggcaaccctatgaaaccaggtaaagccggtaaaccgcttccaggtattgaagtt
gctatagtagataaaaacggaaaccctgtcccacctaacacggtaggctatgtggttata
aaaaatccttggccttctatgatgagaaattgttgggggcaacctgaacgttataaaaaa
tattggactgaaataccaggcaacgtttacaacgctgatgacttagggtctatagatgaa
gaaggtgatattatgatagtaggtagggccgacgatgtactttctgtggctggtcatcgt
ataggcactatggaagtagaaagcgctatagttgatcatgaagctgtggctgaagctgct
gttataggtaaacctgatcccataaagggtgaacgtataaaggcttttgtaatactaaaa
caagattataatccttctgaagagcttaaaaaaagcattcaagagcatgtaaaacacgtg
cttggggctatagcctatccagaagagatagagtttgtagataaattaccaaagacaaga
agtggaaagattatgagaagagtactaaaagccaaagagcttgggcttgatataggcgat
gtatctaccttagaggattaa

DBGET integrated database retrieval system