KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_0893Help
Entry
HY04AAS1_0893     CDS       T00745                                 

Definition
(GenBank) Methenyltetrahydrofolate cyclohydrolase
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Pathway
hya00670  One carbon pool by folate
hya00720  Carbon fixation pathways in prokaryotes
hya01100  Metabolic pathways
hya01120  Microbial metabolism in diverse environments
hya01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hya00001]
 09100 Metabolism
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    HY04AAS1_0893
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    HY04AAS1_0893
Enzymes [BR:hya01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     HY04AAS1_0893
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     HY04AAS1_0893
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ACG57580
UniProt: B4U8W9
Position
840354..841190
Genome map
AA seq 278 aa AA seqDB search
MNILDGKSLAKKIKHNIKQEVKHLERKPKLVVVLVGDDQASLVYVKNKVQACADVGFSSQ
LDMFEKDVEEDVLLNHIKSLNEQEDVDGILVQLPLPSHISMQKVIDTIDPSKDVDGFHPQ
NMGKLFSGDLENAFIPCTPLGIKLLLDEYNIDLKGKNVCIVGAGFIVGKPLSMLMLNYDA
TVSVCHKYTKDIVEYTKTADILISATGVPFLIKDYMVKEGAVVIDVGISKVNGKIVGDVD
FESISQKASFITPVPGGVGPMTVATLLLNTLKAYKQRI
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaatatactagatggtaaaagcttagcaaagaagataaagcacaacataaaacaagag
gtcaaacatcttgagagaaaaccaaagcttgtagtggtgcttgtgggagatgaccaagct
agtttggtgtatgtaaaaaacaaagtccaagcttgtgcagatgttggttttagctcccaa
cttgatatgtttgaaaaagatgtagaagaagatgtgcttttaaatcatattaaaagccta
aatgagcaagaagatgtagatggtatattggtacagcttccattgccatcacatatatca
atgcaaaaagtaatagacaccatagacccatcaaaggatgtagacggctttcatcctcaa
aatatgggcaagcttttttctggggatttggaaaacgcttttatcccttgtacacctctt
ggtattaagcttttattggatgaatacaacatagatctaaaaggtaaaaacgtatgtata
gtaggagctggttttatagtgggtaaacctctttctatgcttatgctaaattacgatgcc
acggtaagcgtatgccacaaatacacaaaagatattgtagaatacacaaaaactgccgat
atacttatatcagctactggagtaccatttttgataaaagactacatggtaaaggagggt
gcagtggtgatagatgttggtatttcaaaagtaaacgggaaaatagttggagatgtagat
tttgaaagtatatcccaaaaggcctcttttataacacctgttcctggtggtgtagggcct
atgacagtagcaacacttcttcttaatacattaaaagcttataaacaacgcatatga

DBGET integrated database retrieval system