KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_1002Help
Entry
HY04AAS1_1002     CDS       T00745                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Pathway
hya00220  Arginine biosynthesis
hya01100  Metabolic pathways
hya01110  Biosynthesis of secondary metabolites
hya01130  Biosynthesis of antibiotics
hya01230  Biosynthesis of amino acids
Module
hya_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:hya00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    HY04AAS1_1002
Enzymes [BR:hya01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     HY04AAS1_1002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N UIM Lig_C
Motif
Other DBs
NCBI-ProteinID: ACG57688
UniProt: B4U977
Position
937772..938710
Genome map
AA seq 312 aa AA seqDB search
MKAHFLDVWDITFDEAKHVIDLSFDFKYNNFNPKSLQNLNIALLFSKPSTRTRVSFEVGI
KELGGNPIFLQESSLQVSRGEDASDSARTLSRYIDGVVIRTGSHQWLLDFSQYASIPVIN
ALTDYTHPCQAISDIFTLFEAFREKTKNIKVLYIGDGNNMANALISAFAIFGLSLTVCTP
KELRPDEENLKRALEVSKQTGAEIILEEDPIKAAKDKDVIYTDVWISMNDEGSKDHKINL
LKDYQVNTKLLSYAKKDVKVMHCLPAKKEQEITRDVFEKYADFIFNQAENRLHTQKALMH
LMFNGTNQMASI
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgcactttttggacgtgtgggatatcactttcgatgaagcgaagcatgtcata
gatttatcttttgattttaaatacaataactttaatcctaaaagcctacaaaacttaaac
atagctctcctttttagcaaaccctctacaagaacaagagtatcttttgaagtaggtata
aaagagcttggcggtaacccaatttttctacaagaatcaagccttcaagtgtcaagagga
gaagatgcttcagatagcgctaggacattgtctcgctatatagacggtgtagttataaga
actggctctcatcaatggcttttagatttttcccaatacgccagtatacctgttataaac
gctcttacagactatactcatccttgccaagctatatcagatatattcacactttttgaa
gcttttagagaaaaaacaaaaaatataaaagtgctttacataggtgatggcaacaacatg
gcaaacgctctaatatcagcttttgctatatttgggctaagcctaactgtgtgtacacca
aaagagcttagaccagatgaagaaaatttaaaaagggctttagaagtttcaaaacaaacc
ggggcagagattatattggaagaagatcctataaaagctgctaaagacaaagatgtaata
tatacggatgtatggatttcaatgaacgatgaaggttcaaaagatcacaaaataaatttg
ttaaaggattatcaggtaaataccaagttgctttcttacgctaaaaaagatgtaaaagtc
atgcattgtttaccagctaaaaaagaacaagaaataacaagagatgtcttcgagaaatat
gcagattttatattcaatcaggcagaaaatagacttcatacacaaaaagctctgatgcat
ttgatgtttaatggaacaaatcaaatggcttctatctaa

DBGET integrated database retrieval system