KEGG   Hydrogenophaga sp. PBC: Q5W_04115Help
Entry
Q5W_04115         CDS       T04491                                 

Definition
(GenBank) phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
hyb  Hydrogenophaga sp. PBC
Brite
KEGG Orthology (KO) [BR:hyb00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Q5W_04115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 DUF2483
Motif
Other DBs
NCBI-ProteinID: AOS78220
UniProt: A0A1C9VBU5
Position
835562..837142
Genome map
AA seq 526 aa AA seqDB search
MKKKSRPFVERHFEALQLATAVAFLLLVGLYASLTGAADAGLSRTAVWLLIIAAAVGAYM
AMNIGANDVANNMGPAVGSGAMTMGWAIVVAAVFEALGAIVAGGDVVSTIKGGIIDPADI
ADPTLFAWVMFSALLAGALWLNLATALGAPVSTTHSIIGAVMGAGIAAGGWGLVHWPTIG
AIVASWVISPVAGALIAAAFLYLIKRSVTYRTEKTEAAARVVPVLIALMVWSYTTYMLLK
GVSQIVKVSFPVALIAGLAVAALVWALVRQPIGRIALRQDNSKDGVNQLFTWPLVCSAAL
LSFAHGANDVANAVGPLAAIYEAVKEGAIATTAGTPMWIMVLGAIGLSVGLGLYGAKLIR
TVGKEITELDQMRAYSIAMAATLTVIVASQLGMPVSTTHISIGAVFGVGFLRELLKVNYA
KMEAVVRAGHQGADREEVEAYMQRFEAAEVQEKKQMLADMKQRAKVRGLDGAVFDKGERK
AFKKAYKKEIVKRSVVMRIVAAWIVTVPATAVLAALLFHLVAAVMA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagaaatcccgtcccttcgtcgagcgccacttcgaggcgctgcaactggccact
gcggtggcctttcttttgctggtgggcttgtacgcctcgctcactggcgcggccgacgcg
gggttgagccgcacggcggtgtggttgctgatcatcgcggccgcggtcggcgcctacatg
gccatgaacatcggcgccaacgacgtggccaacaacatgggcccggccgtgggttcgggc
gccatgaccatggggtgggcgatcgtcgtcgcggcggtgttcgaggccctgggcgccatc
gtcgccggcggtgacgtggtcagcacgatcaagggcgggatcatcgacccggctgacatc
gccgacccgaccttgttcgcctgggtgatgttctcggccctgctggccggcgcgctatgg
ctcaacctggccacggcactgggtgcgccggtgtccaccacgcactccatcatcggtgcc
gtcatgggcgcgggcatcgccgcgggcggctggggcctggtgcattggcccaccatcggc
gcgatcgtcgcgagctgggtcatctcgccggtcgccggggcgctgatcgccgccgccttc
ctgtacctcatcaagcgcagcgtgacctaccgcaccgagaagaccgaggccgccgcgcgc
gtcgtgccggtactgatcgcgctgatggtgtggtcctataccacctacatgctgctcaag
ggcgtgagtcagatcgtcaaggtgtcttttcctgttgcgctgatcgcgggtctggccgtg
gcagcgctggtctgggccctcgtccgccaacccatcggccgcatcgcgctgcgccaggac
aactccaaggacggggtcaaccagctcttcacgtggccgctggtctgctccgccgcgctc
ctgagcttcgcgcacggtgccaacgacgtggccaatgccgtgggcccgctggctgccatc
tacgaggccgtgaaggaaggcgccatcgccaccacggcgggtacgccgatgtggatcatg
gtgctgggcgcgatcggtctgtcggtgggcctggggttgtacggcgccaagctcatccgc
accgtgggcaaggagatcaccgaactcgaccagatgcgggcgtactccatcgccatggcc
gccacgctcaccgtgatcgtggcctcgcaattgggcatgccggtgtcgaccacgcacatc
tccatcggcgccgtgttcggcgtgggtttcttgcgcgagttgctcaaggtcaactacgcc
aagatggaggccgtggtgcgcgccggccaccagggcgccgaccgcgaggaggtcgaggcc
tatatgcagcgcttcgaggccgccgaggtgcaggaaaagaagcagatgctggccgacatg
aagcagcgcgccaaggtacgcggcctggacggcgcggtgttcgacaagggcgaacgcaag
gccttcaagaaggcctacaaaaaggaaatcgtgaagcgctcggtggtcatgcgcatcgtg
gcggcctggatcgtcaccgtgccggccacggcggtgctggctgcgctgctgttccacctg
gtggctgcggtcatggcctga

DBGET integrated database retrieval system