KEGG   Hydrogenophaga sp. PBC: Q5W_06075Help
Entry
Q5W_06075         CDS       T04491                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hyb  Hydrogenophaga sp. PBC
Pathway
hyb00071  Fatty acid degradation
hyb00072  Synthesis and degradation of ketone bodies
hyb00280  Valine, leucine and isoleucine degradation
hyb00310  Lysine degradation
hyb00362  Benzoate degradation
hyb00380  Tryptophan metabolism
hyb00620  Pyruvate metabolism
hyb00630  Glyoxylate and dicarboxylate metabolism
hyb00640  Propanoate metabolism
hyb00650  Butanoate metabolism
hyb00900  Terpenoid backbone biosynthesis
hyb01100  Metabolic pathways
hyb01110  Biosynthesis of secondary metabolites
hyb01120  Microbial metabolism in diverse environments
hyb01130  Biosynthesis of antibiotics
hyb01200  Carbon metabolism
hyb01212  Fatty acid metabolism
hyb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hyb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Q5W_06075
   00630 Glyoxylate and dicarboxylate metabolism
    Q5W_06075
   00640 Propanoate metabolism
    Q5W_06075
   00650 Butanoate metabolism
    Q5W_06075
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Q5W_06075
   00072 Synthesis and degradation of ketone bodies
    Q5W_06075
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Q5W_06075
   00310 Lysine degradation
    Q5W_06075
   00380 Tryptophan metabolism
    Q5W_06075
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Q5W_06075
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Q5W_06075
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Q5W_06075
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hyb04147]
    Q5W_06075
Enzymes [BR:hyb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Q5W_06075
Exosome [BR:hyb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Q5W_06075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AOS78563
UniProt: A0A1C9VCW8
Position
complement(1241213..1242397)
Genome map
AA seq 394 aa AA seqDB search
MSRDVFVVSAVRTAIGTFGGSLKDTPPTALGALVVRESLARAHVDGADVGHVVFGHVVNT
EPRDMYLSRVAALDGGCAQGTPAFNVNRLCGSGLQAIVSAAQGILLGDTEIAIGAGAENM
SRAPYASLNTRFGARMGDVTLIDMMVGALHDPFHKIHMGVTAENIAAKWGISREEQDKLA
AESHRRAQHAVEAGYFKDQIVPVMLKSRKGEVAFGTDEHFRPNATVEDMAKLKPVFAKEN
GTVTAGNASGINDAAAAVVLMSGEEVKARGINPIARLVGYAHAGVDPKYMGIGPVPATQA
VLKKTGLSLNDIDVIEANEAFAAQACAVIRDLGLDPAKVNPNGSGISLGHPIGATGALIT
VKAIHELDRCQGRFALVTMCIGGGQGIAAIFERS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgagacgtcttcgtcgtcagcgcggtgcgcaccgccatcggtaccttcggcggc
agcctgaaagacacgccccccaccgcgctgggcgcactggtggtgcgcgaatcgctcgcg
cgtgcgcacgtcgacggcgccgacgtgggccacgtggtgttcggccacgtggtcaacacc
gagccacgcgacatgtacctctcgcgggtggccgcgctcgacggcggctgcgcccagggc
accccggccttcaacgtcaaccgcctctgcggctcgggcctgcaggccatcgtctcggcc
gcgcagggcatcctgctcggcgacaccgagatcgccatcggcgccggcgccgagaacatg
agccgcgcgccctacgccagcctcaacacccgcttcggcgcgcgcatgggcgacgtgacg
ctgatcgacatgatggtcggcgccctgcacgaccccttccacaagatccacatgggcgtc
acggccgagaacatcgccgccaagtggggcatcagccgcgaagagcaggacaaactggcc
gccgaaagccaccgccgcgcgcagcacgccgtggaagcgggctacttcaaggaccagatc
gttcccgtgatgctcaagagccgcaagggcgaggtggccttcggcaccgacgagcatttc
cgccccaacgccacggtggaggacatggccaaactcaagcccgtgttcgcgaaggagaac
ggcaccgtcaccgccggcaacgcctccggcatcaacgacgccgcggcggccgtggtgttg
atgagcggcgaagaggtcaaggcgcgtggtatcaaccccatcgcgcggctggtgggttat
gcgcacgcaggcgtggacccgaagtacatgggcatcggccccgtgccggccacgcaggcc
gtgctcaagaagaccggcctgagcctgaacgatatcgacgtcatcgaggcgaacgaggcc
ttcgcggcccaggcctgcgccgtcattcgcgatctggggctcgacccggccaaggtcaac
cccaatggctcgggcatctcgctgggccaccccatcggcgccaccggcgcgctgatcacg
gtcaaggccatccacgagctcgaccgctgccagggccgcttcgcgctggtcaccatgtgc
atcggcggtggccagggcatcgccgccatcttcgaacgttcctga

DBGET integrated database retrieval system