KEGG   Hydrogenophaga sp. PBC: Q5W_15460
Entry
Q5W_15460         CDS       T04491                                 

Definition
(GenBank) hypothetical protein
Organism
hyb  Hydrogenophaga sp. PBC
SSDB
Motif
Pfam: LPD37 ART-PolyVal LPD22 DUF3990 TraC_F_IV
Other DBs
NCBI-ProteinID: AOS80267
UniProt: A0A1C9VHP3
Position
3262873..3269868
AA seq 2331 aa
MGSLYDELAAQPAPQPGAAQPTLYDDLVETERQERAVRGSLTATAQTTPERAAQLNYLAQ
VSGMPRAVVETDEGSAKAVAQLREIWDASADSPVLRAKLANPQFTELAKDDVGVLSQIER
GVQATTRYIMGADGRGGLAGDVKAGFHRSSAATSGAFRAVAETLAVPFDFLEQFTAIGGN
PLRRLAEGFESIAQGQTRIADRTTSGVFGVSAGVQSAVQNSKYLPLVAAGPAGAAAALTG
MVAESFGSSYQTARDRGVSQAASLIYGASDAAIEYATERIPLQRLIGDIAVDAGFVRTLG
RQIALEVPGEQIATVLQDMNEWAVLNPERSFRDYLAERPSAAAETLIATVIGTGGNVALT
QGVDRALNGYLQAQVAQTEAGQQALAVQQLLEMSAQSRLRERDPAQFREAVAEMARQAGT
ESVFVDAAVLNQLPPEIQQQLPGLAEQLADALAANSTVELKLADVLAVAPGSGVEQTLVD
NIRMAPDALTAAEATAAGQEAQTLLQQEATRVIAQAGDAVQAQAAAEQVKADVLGQLNAT
GRFGAEVNDAYATLVRDFYTVLGQRLGVSPAQAYQRYPLRVAGQGQGTAAVLEQESPEFK
AWFGDSKVVDADGKPLVVYHGTRADFDTFSPEATMSAGRVESEYGRAFYFTTDPATAESY
GESARQDGAHRVLPVYLSLRNPYIVDLTKVAVRSVYAPGHDPEFVNRLKAKGHDGIIVVD
EDFDGNLPRGTENLQAFASEVVVFEPTQIKSAIGNSGTYDPNDPNILNQSADPADDIATT
LLELGRGEGLYQLPRSQATDIAQMAAEKDLEVRPVDRNAADSTEWMLANTTPEAEGTESW
VVSTSDGRLGTITRDGNEVYINVSAVGEGGGGSAIYDLVANYALNNGLVFIGDPNGVSEA
AMRRRLENMLSSAVKYGTTDHIAPHPDQLLGNTVQGIAPLKWTPGDTLGNIRSLVEASLA
TTEAAAPLTTSEVQFDVDTQQFRQPDGTPADAAVVRSVLSFEPRVRGTGAPGQTTVQRAA
LYRALLQGPDQRRALLAAVRGQQGERGEGLGRTFYQRAKGTFDPAKLLITLNDGADLSTF
LHETGHFFLEVTADLAAAPDAPAQVQQDMAALLKWFGVPDLQTWQAMSLDEQRPHHERFA
ESFEQYLLEGRAPSRDLRSLFRKFRSFLTRVYRSLQSFTEGRDVELSDDVRQVMDRLLAT
DEQIAEAQTLAGMDRDQAATDEALEKFQARSLRDLKWAVNARAKVIAKLQAQARNLRKGI
EAEVRAEVEEVPVYKAMRWLREDTKLSIEGLESLYMGEGDRYALLDWKPLVDRRMAGKTG
VHPDVAADMFGFPSGDALVRAILAAEPLSEVVQGRTDQRMLERHGDLIDQRAIEEAATEA
IHNEARARALATELAAQREIGANRRETGQVDARGRALTVNATLEAARQFAENVAGRKAIG
DLKSAAYAHLQAERRAAKAWEAATAKGDTQAAVQAKQDQLLNHEIYRALVEAQRQVAKAE
ALFARVLKGNPERLVDRGYDPDVVAATRAILAAYGLAPRIGKTAVEYLELVEKNDPDLYA
VLKPSVEATLANAKPYDRLSVDELGALVAEVEAMQQLARRSRQMEVDGNLMDLQEAADQL
KARMEAIGVPLQMPGQDAALTPKQERTRWLQFARALGRRMEQWSEAMDGGRGAFTKLVYG
PVKAAADRYRADRAKYRKQYQQLVDRMAPALRPGEIAAPELGYTFGRGHNGIGHAELLHA
LLHTGNESNKRKLLLGRGWASENGDGSLDTSRWDAFVARMQSSGYLAKEHYDFAQGVWDL
LESTKPLAQKAHRDVFGRYFAEVTADAFETPYGAYRGGHVPAQADPRIVTDAGLRKLAEM
ENENMAFSFPTTSKGFTKARTDYNRPLILDLRTIGQHLDKVLLFSHMEPAVRDVNRLLRD
RGVSARLSKIDPAAYEGALIPWLNRSARQQVETPVVGDGRISRVLSVMRSRAGMSLMFAN
VSNTAQQITGFALAAVKVKPSKLLQATAQYIANPKKTADFVAEQSIFMRDRMRNEVAAIN
DAMDDILLKPSTYAKTQTWAQRHAYFLQAAADNVMSPIVWVGAYNQALETGQTETEAAKA
GDAAVRQTQGSTLPEDVSRIETGPAAARMFTQFVSYFNMLANTNSAELTKIARDIGMKKG
AGKALYVVTMGLLVPIWVAEAIAIAFRGGPEDEDGDGWLDDWLAAVFGMGTIKGSLAMVP
FVGQAANAGLARLNDNPADDRISLSPAVSILEGAVGAPHSVYQALAEDGSARKAVRDLAS
AISLATGLPAHAAARPLGYLAGMADDRVAPTSGLDLARGLVTGAVSPESRQ
NT seq 6996 nt   +upstreamnt  +downstreamnt
atgggctccctgtacgacgagctggcggcccagcccgcgccgcagcccggcgccgcgcag
cccactctctacgatgacttggtcgagaccgagcggcaggagcgcgcggtgcgcggctcg
ttgaccgccacagcccagaccactcccgagcgcgccgcgcagctcaactacttggcccag
gtatcgggcatgccgcgcgcggtggtggagaccgacgaggggtcggccaaggccgtcgcc
cagctacgcgagatctgggacgcctcggccgactctcccgtgctgcgcgcgaagctcgcg
aacccgcagttcaccgagctggcgaaggacgacgtcggcgtgctctcccaaatcgagcgc
ggcgtgcaggcaacgacgcgctacatcatgggcgccgacggtcgcggcggcttggcgggc
gacgtcaaggcaggttttcaccgcagcagcgcggccacctcgggcgccttccgcgcggtg
gccgagacgctggccgtgcccttcgacttcctggagcagttcaccgccatcggcggcaac
ccgctgcgccgcctcgctgagggcttcgagagcatcgcccagggccagacccggatcgcg
gaccgcaccacgagcggcgtgttcggcgtctcggcgggcgtgcagtccgcggtgcagaac
tcgaaatacctgccgctggtcgcggcgggccctgccggcgccgcggccgcgctcaccggc
atggtggcggaatccttcggctcgtcctaccagaccgcgcgcgaccgcggtgtgtcgcag
gccgcctccctgatctatggcgcgtccgacgcggccatcgagtacgccaccgagcgcatc
cccttgcagcgcctgatcggcgacattgccgtcgacgcggggttcgtgcgcacgctgggc
cgccagatcgcgctggaggtgccgggtgagcagatcgccaccgttctgcaggacatgaac
gagtgggcagtgctcaaccccgagcgctcgttccgggactacctggccgaacgccccagc
gcggcggccgagacgctgatcgccacggtcatcggcaccggcggcaacgtggcgctgacc
cagggggtggaccgcgcgttaaacggctacctgcaggcccaggtcgcgcagaccgaggca
ggccagcaggccctggcggtgcagcaactcctggagatgtcggcgcagtcgcggctgcgc
gagcgtgatcccgcgcagttccgcgaagcggtggccgagatggcgcggcaggccggcacc
gagtcggtgttcgtcgacgcggcggtgctcaaccagttgccgcccgagatccagcaacag
ctacccggcctggccgagcagctcgccgacgccctggccgctaacagcacggtggagctc
aagctcgccgacgtgcttgcggtggcacccggcagcggcgtcgagcagacgctggtcgac
aacatccgcatggcgcccgacgcgctcaccgcggccgaggccaccgcggcggggcaagaa
gcgcagaccctgctgcagcaggaggccacgcgcgtgatcgctcaggccggcgacgcggtc
caggcccaggcggcggccgagcaggtcaaggccgacgtgctcggccagctcaacgcgacc
ggccgcttcggcgccgaggtaaacgacgcctacgccaccctggtgcgcgacttctacacc
gtgctgggccagcggcttggcgtgagcccagctcaggcctaccagcgctacccgctgcgc
gtggccggccaggggcagggcacggcggcggtgctggagcaggagtcgccggaattcaag
gcgtggtttggcgacagcaaggtggtggacgccgacgggaagcccctggtcgtgtaccac
gggacaagggcagacttcgacacattttcccccgaagcgaccatgtcggcgggtcgtgtc
gaatcagagtacggtcgcgccttctacttcacgacggacccggcaacagccgaaagctac
ggcgagtccgcccgccaggacggtgcgcaccgtgtcctcccggtgtacctgtctctacgc
aacccgtacatcgtcgacctgacgaaagtggcggtgcgcagcgtctacgctccggggcac
gaccccgagttcgtaaacaggctcaaggcgaaggggcacgacggcatcatcgtcgtggat
gaggactttgacggtaacctcccgcgcggcaccgagaatctgcaggcgttcgcttcggag
gtcgtcgtcttcgaacccacgcagatcaagagtgccatcggcaacagcggcacctacgat
ccgaacgaccccaacatcctcaaccagtccgcggaccccgctgacgacatcgccaccacc
ttgctcgaactcgggcgcggcgaaggcctttaccagctcccccgctcccaggccaccgat
atcgcgcagatggccgccgagaaggatctggaggtccgcccggtcgaccgcaacgcggcc
gacagcacggaatggatgctcgccaacacgacgccggaagccgagggcaccgagtcgtgg
gtggtgagcacctcagacggccgcctgggcaccatcacccgcgacggcaacgaggtctac
atcaacgtctcggccgtcggcgaaggcggtggcggcagcgccatctacgacctggtcgcg
aactacgccctgaacaacgggctggttttcatcggcgacccgaacggggtgagcgaggcg
gcgatgcgccgccggctggagaacatgctctcctcggccgtgaagtacggcacgacggac
cacatcgcaccgcacccggatcagcttttgggcaacaccgtccaggggatcgctcccctg
aaatggacgcccggtgataccctcgggaacatccgctccctggtggaggcctcgctcgct
accaccgaagctgcggccccgctcaccacctccgaggtccagttcgatgtcgacacccag
cagttccgccagcccgacggcactcctgccgatgctgcagtcgtccgatcagtcctgtct
ttcgaaccccgagttcgaggaactggtgcgcctggccaaaccactgtacagcgcgcggct
ctctaccgtgccctccttcaagggccggatcaacgacgagcacttctggcagcagttcgt
gggcagcagggtgaacgaggcgaaggccttggtcgcacgttctatcagcgcgcaaaaggc
accttcgatcctgccaagctgctgatcacgctcaacgacggcgccgacctctccaccttc
ctgcatgagaccgggcacttcttcctggaagtgaccgccgacttggccgcggcgcccgac
gcgccggcgcaggtgcagcaggacatggccgcgctgctcaagtggttcggtgtgccggac
ctgcagacctggcaggccatgagcctggacgaacagcgccctcaccacgagcgcttcgcc
gagagcttcgagcagtacctgctggagggccgcgcacccagccgcgacctgcgctccttg
ttccgcaagttccgcagcttcctcacccgcgtctaccgctcgctgcagtccttcaccgaa
gggcgagacgtcgaactctccgacgatgtgcgccaggtcatggaccgcctgctcgccacc
gatgagcagatcgccgaggcgcagacgctggccggcatggaccgcgaccaggcggccacc
gacgaggcgctggagaagttccaggcccgcagcctgcgcgacctgaaatgggccgtcaat
gcgcgcgcgaaggtgatcgccaagctccaggcccaggcccgcaaccttcgcaagggcatt
gaggccgaggtgcgcgccgaggtcgaggaagtgccggtctacaaggccatgcgctggctg
cgcgaggacaccaagctcagcatcgagggcctggagtcgctctacatgggcgaaggcgac
cgctacgccctgctcgactggaagccactggtcgaccgccgcatggcgggcaaaaccggc
gtgcaccccgacgtggccgccgacatgttcggttttcccagcggcgacgctctggttcgt
gccatcctcgcagccgagccgctcagcgaggttgtgcagggccgcaccgaccagcgcatg
ctggagcgccacggcgacctgatcgaccagcgcgccatcgaggaggccgcgaccgaggcg
atacacaacgaggcccgggcgcgtgcgctggcgactgagctggccgcccagcgagagatc
ggcgccaaccggcgcgagaccggccaggtcgatgcgcgcggtcgcgcgctgaccgtcaac
gccacgctggaggccgcgcgccagttcgccgagaacgtcgccgggcgcaaggcaatcggc
gacctgaagtcggctgcctacgcccatctgcaggccgagcgccgcgcagccaaggcgtgg
gaggcggccacggccaagggcgacacccaggccgcagtgcaggcgaaacaggaccagctc
ctcaaccacgagatctaccgcgccctggtcgaagcccagcgccaggtggccaaggccgag
gcgctgttcgcccgcgtgctcaagggcaatcccgagcggctggtcgaccgcggctatgac
ccggacgtggtcgcggccacgcgcgcgattctggccgcgtacggcctggcgccgcgcatc
ggcaagacggcggtcgaatacttggagctggtcgagaagaacgaccccgacctctacgcc
gtcctcaagccttcggtcgaggcgacgctcgcgaatgccaagccctacgaccggctcagc
gtggacgagctgggcgcactggtggccgaggtcgaggccatgcagcagctcgcgcgccgc
tcgcgccagatggaggtcgacggcaatctcatggacctgcaagaggcagcggaccagctc
aaggcccggatggaggccatcggcgtgccgctgcagatgcccggccaggacgccgccctc
accccgaagcaggagcgcacgcgctggctgcagttcgcccgggcgctgggccggcgcatg
gagcagtggtccgaagccatggatggcgggcgcggcgccttcaccaagctggtctatggg
cccgtgaaggccgccgccgaccgctaccgcgccgaccgcgccaagtaccgcaagcagtac
cagcagctggtcgaccgcatggcgccggccctgcggcccggggagatcgcggcacccgag
ctgggctacaccttcggccgcggccacaacgggatcggccacgccgagttgctgcacgcc
ctgctgcacaccggcaacgagagcaacaagcgcaagctgctgctcggccgtggttgggcc
agcgagaacggcgacggctcgctggacacctcgcggtgggacgccttcgtcgcgcgcatg
cagagctcgggctacctggccaaggagcactacgacttcgcccagggcgtgtgggacttg
ctcgaatcgaccaagccgctggctcagaaggcgcatcgcgacgtgttcggccgctacttc
gccgaggtcacggccgacgccttcgagacgccctacggcgcctaccgcggcgggcacgtg
ccggcgcaggccgatccgcgcatcgtcaccgacgccgggctgcgcaagctcgccgagatg
gaaaacgagaacatggcgttctccttccccacgaccagcaaggggtttacgaaggcacgc
accgactacaaccgcccgctgatcctggacctgcgcacgatcggccagcacctggacaag
gtgctgctgttcagccacatggagcccgcggtgcgcgacgtcaaccgcctgctgcgcgac
cgtggcgtgagcgcacggctgtccaagatcgacccggcggcctacgagggcgcgctgatc
ccttggctgaatcgttcggcacgccagcaggtggagacgcccgtggtcggcgacggccgc
atttcgcgcgtgctctcggtgatgcgcagccgcgccggcatgtcgctcatgttcgccaac
gtgtccaacacggcgcagcagatcacgggcttcgctctggctgcggtgaaggtcaagccc
tcgaagctgctgcaggccacggcgcagtacatcgccaacccgaagaagacggccgacttc
gtcgccgagcagtcgatcttcatgcgcgatcgcatgcgcaacgaggtggcagcgatcaac
gacgcaatggacgacatcctgctcaagccgtccacgtacgcgaaaacccagacctgggcg
cagcgccacgcctacttcctgcaggcggcggccgacaacgtcatgtcacccatcgtatgg
gtgggtgcgtacaaccaggcgctggaaaccgggcaaaccgagaccgaagcagccaaagcg
ggcgacgcggctgtgcgccagactcagggcagcacgctccccgaggacgtgagccgcatc
gagaccggcccggcagccgcgcgcatgttcacgcagttcgtcagctacttcaacatgctg
gcgaacaccaactcggccgagctcacgaagatcgcgcgcgacatcggcatgaagaagggc
gccggcaaggcgctctacgtcgtgaccatgggcctgctcgtgccgatctgggtagccgag
gccatcgccatcgcgttccgtggtgggcccgaagacgaggacggcgacgggtggctcgac
gactggctggccgcggtgttcggcatgggcacgatcaagggcagtctggccatggtgccc
ttcgtcgggcaagccgcgaacgccgggctggcgcgcctgaacgacaacccggccgacgat
cgcatcagcctgtcgccagcggtgagcatcctcgaaggtgccgttggcgcgcctcactcg
gtctatcaggccctggccgaggacggcagcgcgcgtaaggcggtgcgtgacctggccagt
gcgatcagcctggcgaccggtctgcccgcgcacgctgcggcgcgaccgctcggatacctg
gccggcatggccgacgaccgcgtcgcgcccaccagcggccttgacctcgcccgaggcctc
gtcaccggcgccgtgagcccagagagccggcagtag

DBGET integrated database retrieval system