KEGG   Hydrogenophaga sp. PBC: Q5W_18035Help
Entry
Q5W_18035         CDS       T04491                                 

Definition
(GenBank) potassium transporter
  KO
K11747  glutathione-regulated potassium-efflux system protein KefB
Organism
hyb  Hydrogenophaga sp. PBC
Brite
KEGG Orthology (KO) [BR:hyb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hyb02000]
    Q5W_18035
Transporters [BR:hyb02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   Q5W_18035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_H_Exchanger TrkA_N NAD_binding_7 AlaDh_PNT_C ADH_zinc_N Asp-Al_Ex ApbA ThiF NAD_binding_2 2-Hacid_dh_C AdoHcyase_NAD GFO_IDH_MocA XdhC_C UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AOS80727
UniProt: A0A1C9VIZ5
Position
complement(3799044..3800813)
Genome map
AA seq 589 aa AA seqDB search
MAAESGSSELIPVVMLLGAAVVAVPLFKRIGLGSVLGYLAAGLAIGPFGLGWFSDPQTII
HTAELGVVMFLFVIGLEMQPSHLWALRRAIFGLGSLQVLVCGALLTLVGVAFGFSWAVSF
ISAMGFVLTSTAIVMQLLGERGDIATPRGQKIVSVLLFEDLLIVPLLAIVAFLSPDAAAA
AAGASRWASIGIGAGSIALLVAVGVWLLNPLFRVLANAHAREVMTAAALLVVLGAALLMQ
LGGLSMAMGAFLAGVLLSESTFRHQLEADIEPFRGLLLGLFFLGVGMSLDLSAVAQHWAL
IVAGVLSLMVVKALGIYVVARLTHSPHEDALDRAVLMAQGGEFAFVLFAAALAGRVIDPV
VNANMTAIVVLSMALTPLAVLALQRWAPRVSPSTAGAPVPDHQTGAVLIIGLGRVGQIAS
QNLLLLGAEITIIDADPQLAREAEHFGFKVYYGDGTRLDILHAAGADKAKVILVCVDEPS
AATQIVQQCKHAFPHVRVIARSFDREHAAALVKAGVDLQVRETFESAMVMGREAMLALGT
EPAAAEAIEADIRRRDAERFQMELDGGGLVAGRPMILGNLRGRNGTQAH
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atggccgctgaatccggcagttccgaactcatccccgtggtcatgttgctcggcgcggcc
gtggtggccgtgccgctgttcaaacgcatcggcctgggttcggtgctgggctacctggcg
gcgggcctggccatcggccccttcggcctgggctggttcagcgacccgcagaccatcatc
cataccgccgagctcggcgtggtcatgttcctcttcgtcatcggcctggagatgcagccc
tcgcacctgtgggcgctgcggcgcgccatcttcggcctgggcagcctgcaggtgctggtg
tgcggggccctgctcacgctggtgggcgtggccttcggtttttcctgggcggtgtccttc
atcagcgccatgggcttcgtgctcacgtccaccgccatcgtcatgcaactgctgggtgag
cgcggggacatcgccacgccgcgcgggcagaagatcgtctccgtcctgctgttcgaggac
ctgctcatcgtgccgctgctggcaatagtggccttcctgtctcccgacgcggcggccgcc
gccgccggggcctcccgctgggcatcgatcggcatcggcgcgggctccatcgccctgctg
gtcgccgtcggcgtgtggctgctcaacccgctgttccgcgtgctggccaacgcccacgcg
cgcgaggtgatgaccgccgcggccctgctggtggtgctgggcgcggccctgctcatgcaa
ctgggtggcctgtccatggccatgggcgccttcctcgcgggggtgctgctgtcggaatcc
accttccgccaccagctcgaagccgacatcgaacccttccgcggcctgctgctgggcctg
ttcttcctcggcgtgggcatgtcgctggacctgtcggccgtggcgcagcactgggcgctc
atcgtggccggtgtgctctcgctgatggtggtgaaggcgctgggcatctacgtcgtggcg
cgcctcacccacagcccgcacgaggacgcattggaccgcgcggtgctgatggcgcagggc
ggcgagttcgccttcgtgctgttcgcggccgcgctcgcgggccgcgtgatcgacccggtg
gtcaacgccaacatgacggccatcgtggtgctgtcgatggcgctcacgccgctggccgtg
ctggcgctgcagcgctgggcaccgcgcgtgtcaccttcgacggcaggcgcgcccgtgccc
gaccaccagaccggtgcggtgctcatcatcggcctgggccgcgtgggccagatcgccagc
cagaacctgctgctgctgggcgccgagatcaccatcatcgacgccgacccgcagctcgcg
cgcgaggccgagcacttcggcttcaaggtgtactacggcgacggcacgcgcctggacatc
ctgcacgcggcgggcgccgacaaggccaaggtcatcctggtgtgcgtggacgagcccagc
gccgccacgcagatcgtgcagcagtgcaagcacgccttcccgcacgtgcgcgtcattgcg
cgctccttcgaccgcgagcacgcggccgcgctggtgaaggccggcgtggacctgcaggtg
cgcgagacgttcgagtctgcgatggtgatgggccgcgaggccatgctcgcgctgggcacg
gaaccggcggcggccgaggccatcgaggcggacatccgccgccgcgacgccgagcgcttc
cagatggaactcgacggcggcgggctggtggcgggtcggccgatgattctgggaaatctg
cgcggccgcaacgggacccaggcgcactag

DBGET integrated database retrieval system