KEGG   Hydrogenophaga sp. PBC: Q5W_20125Help
Entry
Q5W_20125         CDS       T04491                                 

Definition
(GenBank) esterase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
hyb  Hydrogenophaga sp. PBC
Pathway
hyb00903  Limonene and pinene degradation
hyb00930  Caprolactam degradation
hyb01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hyb00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Q5W_20125
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Q5W_20125
Enzymes [BR:hyb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     Q5W_20125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Peptidase_S9 COesterase Peptidase_S15 Thioesterase Esterase
Motif
Other DBs
NCBI-ProteinID: AOS82302
UniProt: A0A1C9VNI4
Position
complement(4230779..4231705)
Genome map
AA seq 308 aa AA seqDB search
MTTDSSVDAVVAKVKAVYGRWRRDTPVTQMRADWDTLFSATGDAAFEPVTAGGVPCAWVT
APGARTDRVIVYFHGGGFQVGSLASHRELMSRLSADAGVRVLGVDYRLAPEHRHPAPLQD
ALAVLAWLRAEGYAAPHTALAGDSAGGGLALAALLALQGDDATPAAAFVMSAWTDLAATG
ESYETRAASDPIHQRPMIQAMARNYLGKEGDPRDPLASPLYASDEQLAHLPPLLLQVGDD
ETVLSDSEAFAARVNAAGGQAECQAWPGMVHVFQQFPNELPQARDALRQGARFLAAHLGL
VPNGDLTA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgattcatccgtcgacgccgtcgtcgccaaagtcaaagcggtctacggccgc
tggcgccgcgacacccccgtgacgcagatgcgcgccgattgggacacgctgttcagcgcc
accggcgacgccgccttcgaacccgtgaccgccggcggcgtgccctgcgcctgggtcacc
gcccccggcgcgcgcaccgaccgcgtgatcgtctacttccatggcggcggcttccaggtg
ggctcgctcgcctcgcaccgtgaactcatgtcgcgcctctcggccgacgcgggcgtgcgc
gtgctcggtgtggactaccggctggcgcccgagcaccggcaccccgcgccgctgcaagac
gcgctggccgtgctggcgtggttgcgcgccgagggttacgccgcgccccacaccgcactg
gccggggattcggccggtggcggcctggcgttggcagcgctgctcgcgctgcaaggcgac
gacgccacgcccgccgccgccttcgtgatgtccgcctggaccgacctggccgccaccggc
gagagctacgagacccgcgccgcgagcgacccgatccaccagcgccccatgatccaggcg
atggcgcgcaactacctcggcaaagagggcgacccgcgcgatccgctggcctcgccgctg
tacgcgagcgacgaacagctcgcgcacctgccaccgctgttgctgcaggtgggtgacgat
gagaccgtgctgagcgactccgaggccttcgccgcccgggtgaacgccgccggtggccag
gccgagtgccaggcctggcccggcatggtccacgtgttccagcaattcccgaacgagctg
ccccaggcgcgcgacgcgcttcgacagggcgcccgattcctcgcggcccacctcggcctt
gttcccaacggagacctcacagcatga

DBGET integrated database retrieval system