KEGG   Hydrogenophaga sp. PAMC20947: E5678_18090Help
Entry
E5678_18090       CDS       T05960                                 

Definition
(GenBank) carbon-nitrogen hydrolase family protein
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
hyc  Hydrogenophaga sp. PAMC20947
Brite
KEGG Orthology (KO) [BR:hyc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    E5678_18090
Enzymes [BR:hyc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     E5678_18090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: QCB47772
UniProt: A0A4P7REV8
Position
3958632..3959441
Genome map
AA seq 269 aa AA seqDB search
MKVAAIQMVSGISLDANLSEALRLLRQAAQCGAELAVLPEYFCFMGNSDADKLMLAETPG
LGTVQDFLSDAARDLKITLVGGTLPMATDDPTHAANASMVYSPKGAQLARYDKVHLFRYD
NGRESYDESKVLVAGETPVAFDCHSRSTGTDWRVGMSVCYDLRFPELYRALGAEVLLVPS
AFTYTTGQAHWEVLLRARAIENQAYVIASAQGGQHETGRKTWGHTMIIDPWGDVLGLQAQ
GAGVVLADLSKDRLHSVRQQLPALQHRRL
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttgctgccatccagatggtctcgggcatcagcctagacgccaacctaagcgaa
gccttgcgcctgttgcgccaggccgcccagtgcggcgccgagctggccgtgttgcccgaa
tacttctgcttcatgggcaacagcgatgccgacaagctgatgctcgccgaaacccccggc
ctgggcaccgtgcaagattttctctccgacgccgcccgcgatctcaagatcacccttgtt
ggcggcaccctgcccatggccaccgacgaccccacccacgcggccaacgcctccatggtg
tattcgcccaaaggcgcgcagctcgcccgttacgacaaggtccacctctttcgctacgac
aacggccgcgaaagctacgacgaatcgaaggtcctggtggccggggaaacgccggtggcc
ttcgattgccacagccgcagcaccggcaccgactggcgcgtgggcatgagcgtttgttac
gacctgcggtttcccgagctgtaccgtgccctgggggccgaagtgttgctggtgccgtcg
gccttcacctacaccaccggccaggcccattgggaagtgttgctgcgcgcgcgcgccatt
gaaaaccaggcctatgtgatcgccagcgcccagggcggccagcatgaaaccggccgcaag
acctggggccacaccatgatcatcgatccctggggcgacgtgctgggcctgcaggcgcaa
ggcgctggcgtggtgctggccgatctgagcaaagaccggctgcacagcgtgcgccagcag
ctcccggccttgcaacaccgccgcctctga

DBGET integrated database retrieval system