KEGG   Hydrogenophaga sp. PAMC20947: E5678_21865Help
Entry
E5678_21865       CDS       T05960                                 

Definition
(GenBank) NAD(P)-dependent oxidoreductase
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
hyc  Hydrogenophaga sp. PAMC20947
Pathway
hyc00053  Ascorbate and aldarate metabolism
hyc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hyc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    E5678_21865
Enzymes [BR:hyc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     E5678_21865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD NAD_binding_10 RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 NmrA Tachykinin
Motif
Other DBs
NCBI-ProteinID: QCB48444
UniProt: A0A4P7RFF8
Position
4786139..4786960
Genome map
AA seq 273 aa AA seqDB search
MLKQPASPLKFGRLLLTGAAGNLGQVLRPRLKAYCGVLRLSDRSDIGAAGAGEEIVVADL
TDKVGVHAMLQGVDAVAHMGGISTEQPWDQILAGNIVGAVNLYEAARLQGVKRIVFASSN
HVTGFYRQDEVISPNTPPKPDGFYGLSKAFGEDLAQLYWHRWGIETVSLRIGSSLAEPKD
RRMLATWLSHDDLERLVVAALTAPIVGHSIIYGASDNQTSWWDNTPARHIGYRPQDSSDV
FRAEVEARQPTIDRNDPAALYQGGAFVKVSPHG
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaacaacccgcctccccgctgaaattcggccgactgttgctcaccggcgctgcc
ggcaacctgggccaggtgctgcgtccgcgtctcaaggcctattgcggtgtgcttcgcctg
agtgaccgcagcgacatcggcgcggccggggcgggcgaagaaatcgtcgttgccgacctg
accgacaaagtgggcgtgcacgccatgttgcaaggcgtggacgctgtggcgcacatgggc
ggcatttccaccgagcagccttgggaccagatcctggccggcaacatcgtgggcgctgtg
aacctctacgaagccgcgcgtctgcaaggggtgaagcgcatcgtcttcgccagctccaac
cacgtcaccggtttctaccggcaagacgaagtcatcagccccaacaccccgcccaagcca
gacggcttctacgggctgtccaaagccttcggcgaagacctcgcccagctctactggcac
cgctggggcatcgagaccgtgagcttgcgcatcggctccagcttggccgagcccaaagat
cggcgcatgctcgccacctggctgagccacgacgatctggagcgtttggtggtggccgcg
ctcaccgcgcccattgtgggtcacagcatcatctacggcgcatcagacaaccagaccagc
tggtgggacaacacccctgcacgacacatcggctaccgccctcaggattcgtccgatgtg
ttccgcgccgaagtggaggcccgtcagccgaccatcgaccgcaacgacccggccgcgttg
taccaggggggggcgtttgtgaaagtatcgccgcacggctga

DBGET integrated database retrieval system