KEGG   Hydrogenophaga sp. PAMC20947: E5678_21940Help
Entry
E5678_21940       CDS       T05960                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA reductase, degradative
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
hyc  Hydrogenophaga sp. PAMC20947
Pathway
hyc00900  Terpenoid backbone biosynthesis
hyc01110  Biosynthesis of secondary metabolites
hyc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hyc00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    E5678_21940
Enzymes [BR:hyc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     E5678_21940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: QCB48459
Position
4805264..4806547
Genome map
AA seq 427 aa AA seqDB search
MDTHAPSSRIGGFHKFNVAQRIDSVAKFAQLDDADKALLQNTGNLPAELADHLIENFIGT
MNIPVGIATNMKIDGHDRLIPMATEESSVVAAVCNAARQCYDNGGFVTSMSGTEMIAQIQ
LTQVPDPQHARLKILERKETIREMCDACDPILVKLGGGFRDLEVRVLDTRGGTMVVTHLI
VDTRDAMGANAVNTMAERIAPHIAEWTLGKSNLRILSNLADRRLARARCTWRLADIGGAE
VRDAMVAAYHFAEADPYRAATHNKGIMNGISAVVMATGNDTRAVEAGAHAYAARSGRYSS
LSTWEVSAEGDLVGSIEIPMAVGLVGGATKLHPCAKVALKVLNAKTAEDLARVIAAVGLA
QNFSAMKALATTGIQKGHMSLHSQNIAMMAGALGEEIDLVARVLVELGTVRLDVAEEELR
RFRSARV
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggacacccatgctccgagcagccgcattggcggtttccacaaattcaacgtggcccag
cggatcgatagcgttgcaaagtttgcgcaactggatgacgctgacaaggccttgttgcag
aacaccggcaatctgcctgcagagctggccgatcacctcattgaaaacttcatcggcacc
atgaacattccggtgggcattgccaccaacatgaagattgatgggcatgaccgcctgatt
cccatggccactgaagagtcttccgtggtggctgctgtgtgcaacgcggcgcgccagtgc
tacgacaacggaggctttgttacttccatgtcgggtaccgaaatgattgcgcaaatccag
cttacacaggttcctgatccgcaacatgctcgcttgaagatcctcgagcgcaaagaaact
attcgagaaatgtgcgatgcctgcgacccgattttggtcaagctcggcggcggctttcgc
gatcttgaagtgcgcgtgttggatacccgaggtggcaccatggtggtcacccatctcatt
gtcgatacccgggacgcgatgggggccaacgcggtcaacaccatggccgaacgcatcgcg
ccgcacattgccgaatggacgctaggaaaaagcaacctgcgcatcttgtccaatctggct
gaccggcgtttggcccgtgctcgctgtacctggcgtttggccgacatcggtggcgccgaa
gtgcgcgacgccatggtggccgcctaccactttgcagaagccgacccttaccgtgcggcg
acacacaacaagggcatcatgaacggtatcagtgccgtggtgatggccaccggcaacgac
actcgggcggttgaagccggcgcccacgcctatgccgctcgcagtggtcgctattccagc
ctctcgacatgggaggtgtcggctgaaggagacctggtcggctccattgaaatccccatg
gctgttggcctggtgggtggtgcgaccaaacttcacccctgtgccaaagtggcgctcaag
gttctcaatgcgaaaacggcagaggatcttgctcgcgttatagctgcggtggggcttgcc
cagaacttctcggcgatgaaggcgctggcgaccaccggtatccagaaagggcacatgtcg
ctacattcgcagaacattgccatgatggcaggagctttaggggaagaaatagaccttgta
gcccgcgtattggttgagctcgggacagtgcgtctggatgttgctgaggaagagcttaga
cggttccgatcagcaagagtttga

DBGET integrated database retrieval system