KEGG   Hydrogenophaga sp. PAMC20947: E5678_22055Help
Entry
E5678_22055       CDS       T05960                                 

Gene name
arsB
Definition
(GenBank) ACR3 family arsenite efflux transporter
  KO
K03325  arsenite transporter
Organism
hyc  Hydrogenophaga sp. PAMC20947
Brite
KEGG Orthology (KO) [BR:hyc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hyc02000]
    E5678_22055 (arsB)
Transporters [BR:hyc02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   E5678_22055 (arsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBF SBF_like
Motif
Other DBs
NCBI-ProteinID: QCB48481
UniProt: A0A4P7RHC3
Position
complement(4825034..4826047)
Genome map
AA seq 337 aa AA seqDB search
MGLFERYLTVWVALGIAAGVGLGLVMPGVFQTVASLEVAQVNLVVAVFIWVMIYPMMIQI
DWHAVKNVGQKPQGLLLTLVINWLIKPFTMAALGVLFFQHVFAAWVDPQMASEYIAGMIL
LGVAPCTAMVFVWSQLVKGDANYTLVQVSVNDLIMVVAFAPIAAFLLGVTNVTVPWQTLV
LSTVLYVVLPLLAGMATRQILLKQSPGALSHFVARLKPWSVVGLIATVVLLFGFQARTIV
DQPFVIALIAVPLILQTYGIFFIGWWGAKLLKLPHDIAGPACLIGTSNFFELAVAVAISL
FGLNSGAALATVVGVLVEVPVMLSLVAMINAWRPKAA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgggtttgtttgaacggtatctgacggtatgggtggctttgggtatcgccgccggggtg
ggcctgggtctggtgatgccgggtgtgttccagacggtggcttcgcttgaagtcgcgcag
gtcaacctggtcgtcgcggtcttcatctgggtgatgatttatccgatgatgatccagatc
gactggcacgcggtgaagaacgtgggccagaagccccaaggcctgttgctcacgctggtc
atcaactggctcatcaaacccttcaccatggccgcgctgggcgtcctgttttttcagcat
gttttcgcggcctgggtagacccccagatggccagcgaatacatcgctggcatgatcctg
ctgggcgtggcgccttgcacggccatggtctttgtgtggagccagctcgtcaaaggcgat
gccaactacaccttggtccaggtctcggtgaacgacctcatcatggtggtcgcctttgcc
ccaatcgcagcctttttgctgggcgtgaccaatgtgaccgtgccttggcaaacgctggtg
ctttcgaccgtgctctacgtggtgttgcctttgctggcaggcatggccacccgccagata
ttgctcaaacagtctcccggtgcgctcagccactttgttgcgcgactcaagccctggtcg
gtggtgggattgattgcgaccgtcgtcttgctgtttggctttcaggcccgcaccatcgtc
gatcagcctttcgtgattgcgctgatcgccgtccccctgattcttcagacctatggcatc
ttcttcattggctggtggggcgccaagctgctcaagctgccgcacgacattgccgggccc
gcctgcttgatcggcacgtccaatttcttcgagctggccgtggcggtggccatttcgttg
tttggcctgaattccggtgcggcattggccaccgtggtgggcgtgctggtcgaagtgccc
gtcatgctctcgctggtggccatgatcaacgcctggcgccccaaagccgcatga

DBGET integrated database retrieval system