KEGG   Hymenobacter sp. DG25B: PK28_07220Help
Entry
PK28_07220        CDS       T03500                                 

Definition
(GenBank) glycosyl hydrolase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
hyd  Hymenobacter sp. DG25B
Pathway
hyd00511  Other glycan degradation
hyd00600  Sphingolipid metabolism
hyd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hyd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    PK28_07220
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PK28_07220
Enzymes [BR:hyd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     PK28_07220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydro_59
Motif
Other DBs
NCBI-ProteinID: AIZ65080
UniProt: A0A0A7LP61
Position
complement(1678306..1679823)
Genome map
AA seq 505 aa AA seqDB search
MTNKLLSLLLLSASIGLSPALAQKTSKPTTPKPATQKTSKAAGKVSAFSVAGKKAQVFTT
AANTELRLSAAGDLAFQPAPQPLETQLCVFVDPQHTFQTMLGIGAAMTDASAETFAKLPK
AAQQEFMQAYFSPTKGIGYTLARTPINSTDFSSGSYTYIADKDTELKTFSVKHDEQFRIP
FIKQAMAAAGGKLTMYVSPWSPPAWMKDNNDMLHGGKLLPQYRQPWANYYIKFIKEYEKQ
GIPIWGLTVQNETMAKQIWESCLYTAEEERDFIKEYLGPTLHKAGMKDKKLIAWDHNRDL
VYQRASTILDDPKAAQYVWGIGYHWYETWTGAGMNFENLRRVHETFPNTNLIFTEGCVEK
FSLDQVNDWRLGEKYGMSMINDFNSGTVGWTDWNILLDEKGGPNHVGNFCFAPIHGDTRS
GKLLYTNSYYYIGHFSRFIRPGAKRIISSSSRDVLSTTAYRNPDGSVAVVVMNGTDTKQD
FQLRLQGQAASAVSLPHSIQTFVIQ
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacaagctcctttctcttctgctgctctcggcctccatcggcctcagccctgcc
ctggcacagaaaaccagtaagcctactaccccaaaacccgccacccagaaaaccagcaaa
gcggccggtaaggtcagcgcgttttccgtggcgggcaaaaaagcccaggtgtttaccacg
gccgcaaacaccgagctgcgcctttccgccgccggcgacctggcctttcagccggccccg
cagccgctggaaacccagctgtgcgtgttcgtagacccccagcacactttccagacgatg
ctgggtattggagccgccatgacggatgcctcggccgaaacctttgccaaactgcccaaa
gcggcccagcaggagtttatgcaggcctacttcagccctaccaagggcattggctacacc
ctggcccgcacgcccatcaacagcaccgatttttccagcggcagctatacctacatagcc
gataaggatactgagctgaaaaccttcagcgtgaagcacgatgagcagttccggattccc
ttcatcaagcaggccatggccgcggccggtggcaagcttacgatgtacgtgagcccctgg
agcccgcccgcctggatgaaggataataacgatatgctgcacggcggcaagctgctgccc
cagtaccgccagccctgggccaactactacatcaagttcattaaggagtacgaaaagcag
ggcattcccatctggggcctcacggtgcagaacgaaaccatggccaagcagatctgggag
tcctgcctgtacacggctgaggaagagcgcgactttattaaggaatacctggggccaacg
ctgcacaaagcaggcatgaaggacaagaagctcattgcctgggaccacaaccgcgaccta
gtataccagcgcgccagcactattctggatgaccccaaagcggctcagtacgtgtggggc
attggctaccactggtacgaaacctggaccggcgccggcatgaacttcgagaacctgcgc
cgggtgcacgaaaccttccccaacaccaacctgattttcacagaaggctgcgtggagaag
tttagcctggaccaggtgaacgactggcgcctgggcgagaagtacggcatgtcgatgatt
aacgacttcaacagcggcaccgtgggctggacggactggaatattctgctggatgagaag
ggcggccccaaccacgtgggcaacttctgctttgcgcccattcatggcgatacgcgcagc
ggcaagctactgtacaccaacagctactattacatcgggcacttctcccggttcatccgg
cccggcgctaagcgcatcatcagctccagcagccgcgacgtactcagcaccaccgcctac
cgcaaccccgatggcagcgtggccgtggtggtaatgaacggcactgataccaaacaggat
ttccagctgcggctgcagggccaggccgcctcggccgtgagtttgccgcactccatccag
acgtttgtaattcagtaa

DBGET integrated database retrieval system