KEGG   Hymenobacter sp. DG25B: PK28_10840Help
Entry
PK28_10840        CDS       T03500                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
hyd  Hymenobacter sp. DG25B
Pathway
hyd00010  Glycolysis / Gluconeogenesis
hyd00020  Citrate cycle (TCA cycle)
hyd00620  Pyruvate metabolism
hyd01100  Metabolic pathways
hyd01110  Biosynthesis of secondary metabolites
hyd01120  Microbial metabolism in diverse environments
hyd01130  Biosynthesis of antibiotics
hyd01200  Carbon metabolism
Module
hyd_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hyd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PK28_10840
   00020 Citrate cycle (TCA cycle)
    PK28_10840
   00620 Pyruvate metabolism
    PK28_10840
Enzymes [BR:hyd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     PK28_10840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-ProteinID: AIZ64071
UniProt: A0A0A7LL41
Position
2540970..2542595
Genome map
AA seq 541 aa AA seqDB search
MQDSAANVLPRLQPLGFTRTSGPVHLNLTPAELVEQALRRGEGTLTDNGALMADTGKFTG
RSPKDRFVVKDASTEDSVWWGDINIAFDPAKFDQLQAKMVQYLADKELFVRDAYAGAHPD
YQLKLRVVNELAWHNLFCYNMFLRPAEGADTTWTPDFSIICAPGFEADPAVDGTRQSNFA
IINFAKKMILIGGTGYAGEMKKGIFGVLNYLLPHEKNTLSMHCSANIGEQGDTAIFFGLS
GTGKTTLSADPHRGLIGDDEHGWMPGNAGIFNFEGGCYAKVIDLSQEKEPQIWDAIRFGS
IVENTRFIPGTRTVDYTNKSVTENTRTAYPIGFIDNAVEPSVGGVPKNIFFLTADAFGVL
PPISKLDKSHAMYHFMSGYTAKVAGTEVGITEPQTTFSACFGQVFLPLHPTKYAEMLGKK
MEEHDVNVWLINTGWTGGSYGTGSRMKLPYTRAMITAALNGKLDDVEFVKHPVFGVEMPV
SLAGVPAEILDPRNTWSDKEAYDKTAASLAEKFVHNFQKYADFANEEILAGAPKVAAEAG
V
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgcaagattctgccgccaacgtcctcccccgccttcagcctctgggctttacgcgtacc
tctggtccggtccacctgaaccttacccccgccgagctggtagaacaggccctgcgccgc
ggcgaaggcaccctcaccgacaatggcgccctcatggctgacaccggcaaattcaccggc
cgctcgcccaaggaccgctttgtagtgaaggatgccagcaccgaagacagcgtttggtgg
ggcgacatcaacattgcctttgatccagcgaaatttgatcagctgcaggccaaaatggtg
cagtacctggccgacaaagagctgtttgtgcgtgatgcctatgccggtgcccaccccgac
tatcagctgaagctccgcgtagtaaacgagctagcctggcacaacttgttctgctacaac
atgttcctgcgccccgccgaaggcgctgatactacctggacgccggacttcagcatcatc
tgtgcccctggctttgaggccgaccccgccgtggatggcacccgccagagcaatttcgct
attatcaacttcgcgaagaagatgattctgattggtggtacgggctacgccggcgagatg
aagaaaggcatctttggcgtgctgaactacctgctgccccacgagaaaaacacgctgagc
atgcactgctcggccaacattggcgagcagggcgacaccgccattttcttcggcctatcg
ggcaccggcaagaccaccctctccgccgacccgcaccgcggcctcatcggcgacgatgag
cacggctggatgcccggcaacgccggtatcttcaactttgaaggcggctgctacgccaag
gttatcgacctgagccaggagaaggagccccagatctgggatgctattcgctttggctcc
attgtggagaacacacgctttattcccggcacccgcacggtagactacaccaacaaatcg
gtaacggaaaacacgcgcacggcttatcctatcggctttattgataatgcggtagagcct
tctgtgggcggcgtgcccaagaacatcttcttcctcaccgccgatgcctttggcgtactg
cctcccatcagcaagctggacaagagccatgctatgtaccacttcatgtcgggctacacg
gctaaggtggcgggcacagaagtaggcattacggagccccagaccaccttctcggcctgc
tttggccaggtattcctgcccctgcaccccactaagtacgcggagatgctgggcaagaag
atggaggagcacgatgtaaacgtgtggctgattaacaccggctggacgggcggtagctac
ggcaccggctcccgcatgaaacttccctacacccgcgccatgattacggccgccctaaac
ggtaagctggatgatgtggagtttgtgaagcacccggtattcggcgtagaaatgcccgtt
tcgctggctggcgttcctgccgaaatactggacccgcgcaacacgtggtcggataaagaa
gcttatgataaaacggctgcttcgctggcggagaaattcgtgcacaacttccagaagtat
gccgatttcgccaacgaagaaattctggccggcgccccaaaggtggccgctgaagctggc
gtataa

DBGET integrated database retrieval system