KEGG   Hymenobacter sp. DG25B: PK28_13110Help
Entry
PK28_13110        CDS       T03500                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
hyd  Hymenobacter sp. DG25B
Pathway
hyd00480  Glutathione metabolism
hyd00590  Arachidonic acid metabolism
hyd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hyd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    PK28_13110
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PK28_13110
Enzymes [BR:hyd01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PK28_13110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin PGP_phosphatase
Motif
Other DBs
NCBI-ProteinID: AIZ64386
UniProt: A0A0A7LLZ4
Position
complement(3042091..3042681)
Genome map
AA seq 196 aa AA seqDB search
MKAFFLVVLGGMAACGFSSSTASKTATTAPATMTEATAQGTVYDYTVKDINGKDVSLSQY
KGKKLLIVNTASECGYTPQYKELEELNKKYGDRVTVLGFPANNFGGQEPGTNQEIATFCE
KNYGVTFPLFSKVSVKGIDTDPLFKYLADKSKNGAVGEAPTWNFCKYLVDEQGHVLKFYP
SKVKPMSEELVADILK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcttttttcttagttgtgctgggcggaatggccgcctgtggtttctcctcatct
actgcgtctaaaaccgcaactaccgctcccgctaccatgaccgaagctaccgcgcaagga
accgtgtatgattacacggtgaaggatatcaatggcaaagacgttagcctcagccagtac
aaaggcaagaagctgctcattgtcaacacggcctcggagtgcggctacacgccccagtac
aaggagctggaagagctgaacaagaagtacggcgaccgggtaaccgtgctgggtttcccc
gccaacaacttcgggggacaggaaccgggcaccaaccaggaaattgccaccttctgcgag
aagaactacggcgtaaccttcccgcttttctccaaggtttccgtgaagggcatcgacacg
gatccgctgttcaagtacctcgctgataagtcgaagaacggtgcggtaggggaggcgcct
acctggaatttctgcaaatatctggtagatgagcaggggcacgttcttaagttctaccct
tccaaagtaaagcccatgagcgaagagctggtggccgatattttaaagtag

DBGET integrated database retrieval system