KEGG   Hymenobacter sp. DG25B: PK28_13970Help
Entry
PK28_13970        CDS       T03500                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
hyd  Hymenobacter sp. DG25B
Pathway
hyd00620  Pyruvate metabolism
hyd00630  Glyoxylate and dicarboxylate metabolism
hyd01100  Metabolic pathways
hyd01110  Biosynthesis of secondary metabolites
hyd01120  Microbial metabolism in diverse environments
hyd01200  Carbon metabolism
Module
hyd_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:hyd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PK28_13970
   00630 Glyoxylate and dicarboxylate metabolism
    PK28_13970
Enzymes [BR:hyd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PK28_13970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase Rad52_Rad22
Motif
Other DBs
NCBI-ProteinID: AIZ64501
UniProt: A0A0A7LM97
Position
complement(3252371..3254002)
Genome map
AA seq 543 aa AA seqDB search
MSPFAEPQTVAPESVYLTPERVRVTGAFKPEYAAILTPSALAFVAELHRRFDPTRQHLLA
RREARQLEFEAGKLPDFLPETRLIREKPWTVAPIPDDLQDRRVEITGPVDRKMMINALNS
GAKVFMADLEDSNAPTWENVVEGQRNLRDAVRRTISLSTPAKEYKLNEETATLVVRPRGW
HLVEKHVLVDGEPICASLFDFGLYYFHNAHELCARGSAPYFYLPKIENHLEARLWNDVFG
FAQWSLKLPKCSIKATVLIETLPAAFELNEILYELREHSAGLNCGRWDYIFSYIKRLGLK
PEFRLPDRAQVTMAVPFMAAYSQLVIQTCHRRGVHAIGGMAAQIPIKNNPEANEAALEKV
RLDKVREAKNGHDGTWVAHPGLVPVALDVFNELMPGPNQIDNKREDVQVTAADLVQAPEG
TITEEGLKLNIDVAIQYIESWLRGNGCVPIYNLMEDAATAEISRAQVWQWVHTPGTTLTD
GRAVTLDLYRSLVPGQLEKIKALVGEEQFEKGRYLEAARLFDRLVTSEKFVEFLTIPAYE
QLA
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccctttgctgaaccccagacagtagcacccgagtctgtttaccttacgccggag
cgcgtacgggtaaccggagccttcaagccggagtatgcggccatcctcacgccctcggcg
ctggcctttgtggccgagctgcaccgacgtttcgaccccacgcgccagcatttgctggcc
cgccgggaagcgcggcagctggagtttgaggccggcaagctgcccgactttctcccggaa
acccgcctgatccgggaaaagccctggacggtagcgcccattccggacgatttgcaggac
cgccgcgtggaaattaccggccccgtagaccggaaaatgatgatcaacgccctgaactcc
ggcgccaaggtgtttatggctgatctggaagattccaacgcgcccacctgggagaatgta
gtggaaggccagcgcaacctgcgcgacgccgtgcgccgtaccattagcctgagcacgccg
gctaaagagtacaagctgaatgaggaaaccgccaccctggtagtgcgcccccgcggctgg
cacctggtagaaaaacacgtgctggtagacggtgagcccatttgcgcctctttgttcgat
ttcggcctgtactacttccataatgcccacgaactgtgcgcccgcggcagcgccccatat
ttctacctgcccaaaattgaaaatcacctggaagcacgcctgtggaatgatgtgttcggg
tttgcgcaatggtcgttgaagctgcctaagtgcagcattaaggctaccgtgctgattgaa
acactgcccgccgctttcgagctgaacgaaatcctgtatgagctgcgcgagcacagcgcc
ggcctcaactgcggccgctgggactatatcttttcctacatcaagcggctgggcttgaag
cccgaattccgcctgcccgaccgtgcccaggtaaccatggcggtgccttttatggccgcc
tactcgcagctggttatccagacctgccaccgccgcggggtgcacgccatcggcggcatg
gcggcccaaattcccatcaaaaacaaccccgaggctaacgaagcagccctggagaaagta
cgcctggataaagtgcgcgaggccaaaaacggccacgatggcacctgggtagcacaccct
gggctggtaccggtggccctggatgtgtttaatgagctgatgcccggccccaaccagatt
gacaacaagcgcgaagacgtgcaggtaacagccgccgacctggtgcaggcccccgaaggc
accatcacggaagaaggcctgaagctgaacatcgacgtagccattcagtacattgagtcc
tggctgcggggcaacggctgcgtgccgatatataacctgatggaagacgccgccaccgcc
gaaataagccgggcgcaggtgtggcagtgggtgcacacgcccggtaccacgctcaccgat
ggccgcgccgtaaccctggatctgtaccgctccctggtgccgggtcagctggagaaaatt
aaagcactggtaggagaggagcagtttgagaaaggccgctacctggaagccgcccgcctg
ttcgaccggctggtaaccagtgaaaagtttgtggaatttctgaccattcccgcctatgag
cagctggcttaa

DBGET integrated database retrieval system