KEGG   Ephemeroptericola cinctiostellae: DTO96_101675Help
Entry
DTO96_101675      CDS       T05560                                 

Gene name
ltaE_1
Definition
(GenBank) Low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
hyf  Ephemeroptericola cinctiostellae
Pathway
hyf00260  Glycine, serine and threonine metabolism
hyf01100  Metabolic pathways
hyf01110  Biosynthesis of secondary metabolites
hyf01120  Microbial metabolism in diverse environments
hyf01130  Biosynthesis of antibiotics
hyf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hyf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DTO96_101675 (ltaE_1)
Enzymes [BR:hyf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     DTO96_101675 (ltaE_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase OKR_DC_1
Motif
Other DBs
NCBI-ProteinID: AXF85935
UniProt: A0A345DC47
Position
complement(1845741..1846853)
Genome map
AA seq 370 aa AA seqDB search
MTHSTHSIKALVETLQAMPAPERTFASDNSAGAHPAVMAALAQANQNHALAYGSDPWTAQ
TQAHFKSLFGEHTESLLVFGGSGANVMALATLLQAGECVVCSDKAHIALDETGAPERALG
AKLLMLPTCDGKIKPEQLEALKSMVGVQHSAQPGVLSITQPTELGALYSVEEIAALCDTA
HAMDMRVHLDGARIANATAALGGTINALRAFTSDVGVDVLSFGGTKAGLMFGEAVIYLNP
IYARRAKYVRKQVNQLPSKMRFVAAQFNALLTDNLWIQLAQQANAMSRRLYDATVSLKGI
SFDAVPQVNSSFPIIPAQLITPLSDWCMFWDWDMSRSQVRWMTAWDTTEVDVDHFAAGVE
AALSVIHSNI
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgactcattctacccattctataaaagccctcgtagaaacacttcaagccatgcctgcg
cccgagcgcacgtttgccagcgacaactccgcaggtgcacaccccgcagtcatggcggct
ttggcacaagccaatcaaaaccatgccttggcttacggcagtgacccatggacggcgcag
acgcaagcccattttaaaagtttatttggtgaacacacagagtccttgctggtgtttggt
ggctcgggtgccaatgtgatggctttggccactttattgcaggcgggtgaatgtgtggtg
tgcagcgataaggcgcacattgcgctggatgaaacgggtgcacctgagcgagctttgggt
gccaagttactcatgttgccgacctgcgatggcaaaatcaagcctgaacaacttgaagca
ttgaaatcaatggtgggcgtacagcacagtgcacagcctggtgttttgtccatcacccaa
ccaactgaattgggtgcactgtactctgtcgaagaaattgcagccttatgcgacacggca
catgcaatggacatgcgcgtacacctcgatggggcgcggattgccaatgcgaccgccgca
ctcggcggcacaatcaatgcattgcgtgctttcacgagcgatgtgggcgttgatgtgctc
agttttggaggtacaaaagcggggctgatgtttggtgaggccgtgatttatttgaacccc
atttatgctcggcgtgccaagtatgtgcgcaaacaggtcaaccaactgccatccaaaatg
cggtttgtggccgctcaattcaatgctttactgacggataacctgtggattcaattggca
caacaagccaatgccatgagtcgtcgtttgtacgacgcgacggtctcgctcaaaggcatt
tcatttgacgctgtaccgcaagtcaacagcagtttcccgatcattccagctcaactcatc
acgccattaagtgactggtgcatgttttgggattgggacatgagccgttctcaggtgcgc
tggatgaccgcatgggatacaactgaagttgatgtcgatcattttgcggctggtgtagaa
gccgcattgtcagtcattcactcaaatatttaa

DBGET integrated database retrieval system