KEGG   Hydromonas sp. F02: DTO96_101681Help
Entry
DTO96_101681      CDS       T05560                                 

Definition
(GenBank) 2-oxoglutaramate amidase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
hyf  Hydromonas sp. F02
Brite
KEGG Orthology (KO) [BR:hyf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DTO96_101681
Enzymes [BR:hyf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     DTO96_101681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AXF85941
UniProt: A0A345DC53
Position
complement(1852173..1853075)
Genome map
AA seq 300 aa AA seqDB search
MSSNNSISEDHDVAPRIACVQMVSSTDVLVNISTARELIAKAVADGAQVVVLPEYFCIMG
RNETDKLAVAEDFVGEATHVGTPLQHFLRQQAIQHQIYLIAGTVPLKSNDPNKVFNTTIV
YAPTGRIEARYDKIHLFGFTNGIESYNEGDAIMAGDATAPCIWDSPWGRIGIAICYDIRF
PELFRMAGEVIAWVVVAAFTYTTGQAHWEILLRARAIENQCYLAACGQGGTHENGRRTFG
HTMWIDPWGAVQAVLPEGVGVVSGNLLNSRIARVRASLPALKHRVMSCGSALEQPVKDGK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgagttcaaacaattcaatttcagaagaccatgatgttgcgccacgcatcgcatgtgtg
caaatggtgtcctccaccgatgtgcttgtgaacatcagcacagcgcgtgagttgattgcg
aaagcggtcgccgatggtgcacaagtggtggttttgcccgagtatttttgcatcatgggg
cgcaatgagaccgataaactggctgtggcagaggactttgtgggggaggcgacccatgtt
gggacgcctttacaacattttttacgtcaacaggccattcaacatcagatttacttgatt
gcaggtacggttccattgaaaagcaatgatccgaataaggtgttcaatacgacgatcgtt
tatgccccaactggtcgcattgaagcgcgctacgataaaattcatttgtttggtttcacc
aatggcattgaatcgtacaacgagggtgatgcgatcatggcgggtgatgcgactgcgccg
tgcatatgggatagcccttggggacggattgggattgcgatttgttatgacattcgcttc
ccagaattgtttcgcatggctggggaggtgattgcttgggtggtggtggcagcttttacg
tacaccacagggcaggcgcattgggaaattttactgcgtgcacgtgcaattgaaaaccaa
tgttaccttgccgcatgtggacagggcggcacgcatgaaaatggccgtcgtacatttggt
cacacaatgtggattgacccatggggcgcggtgcaagcggttctgccagaaggtgtcggc
gtggtcagcggcaatctgttaaactctcgcattgcgcgagtgcgggcaagtttgcctgca
ttgaagcacagggtcatgagttgcggcagcgcattggaacaacccgtaaaagatggaaaa
taa

DBGET integrated database retrieval system