KEGG   Hydromonas sp. F02: DTO96_101978Help
Entry
DTO96_101978      CDS       T05560                                 

Gene name
acnD
Definition
(GenBank) 2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
hyf  Hydromonas sp. F02
Pathway
hyf00640  Propanoate metabolism
hyf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hyf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    DTO96_101978 (acnD)
Enzymes [BR:hyf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     DTO96_101978 (acnD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: AXF86232
UniProt: A0A345DCZ4
Position
2183145..2185814
Genome map
AA seq 889 aa AA seqDB search
MTTLESVGKKTPTLFKGTEQEHTMTNHRKPLPNTNIDYFDTREAVNALQAGAYEQLPYTS
RVLAEQLVRKAADNSTDDATLNAWLEQLIGRKQELDFPWYPARVVCHDILGQTALVDLAG
LRDAIAEQGGDPAKVNPVVQTQLIVDHSLSVECGGFDPDAFTKNRAIEDRRNEDRFHFIN
WCATAFENVNVIPAGNGIMHQINLEKMSPVIQNRNGVAFPDTCVGTDSHTPHVDALGVIA
IGVGGLEAETVMLGRASMMRLPDIVGVELTGKRQAGITATDIVLALTEYLRKERVVGAYV
EFFGEGADSLSIGDRATISNMTPEYGATAAMFYIDQQTIDYLKLTGRDPEQVALVENYAK
TTGLWADALKTAQYPRTLSFDLSTVGRNMAGPSNPHARVATADLTAKGIAGAWTETAGEM
PDGAVIIAAITSCTNTSNPRNTVAAGLLARKALELGLTRKPWVKTSFAPGSKVAEIYLKE
AGVLTDLEQLGFGIVAFACTTCNGMSGALDPVIQQEIIDRDLYTTAVLSGNRNFDGRIHP
YAKQAFLASPPLVVAYAIAGTIRFDIENDALGHTADGTPIYLKDIWPSDEDIDALVAKSV
HPEQFRKIYIPMFDAGKAEKSISPLYDWREMSTYIRRPPYWEGALAGERTLKGMRPLAVL
PDNITTDHLSPSNAIMMNSAAGEYLHKMGVPEEDFNSYATHRGDHLTAQRATFANPKLFN
EMVHNTDGTVKQGSLARIEPEGKVTRMWEAIETYMERKQPLIIIAGADYGQGSSRDWAAK
GVRLAGVEAIAAEGFERIHRTNLVGMGVLPLEFKAGTNRLTLGLDGTETYDVIGERTPRA
DLTLVINRKNGERLEVPMTCRLDTAEEVGIYEAGGVLQRFAQNFLEGSV
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atgaccactctagaatctgtcggtaaaaaaacacccaccctctttaagggaactgagcaa
gagcacaccatgacaaaccaccgcaaacccctcccaaacaccaacatcgactacttcgac
acccgtgaagccgtcaatgccctccaagcgggcgcatacgaacaactgccctacacttcg
cgcgtcctcgccgaacagttggtgcgcaaagccgctgacaactcaaccgacgacgccacg
ctcaacgcatggttagaacaactcatcggtcgcaaacaagagctcgatttcccttggtat
ccagcgcgtgtggtgtgtcacgacattttgggtcaaacggcattggtcgatttggctggt
ttgcgcgacgcgattgcggaacaaggcggcgaccctgccaaagtcaaccccgtggtgcaa
acacaactcatcgtcgatcactcattgtccgttgaatgcggtggtttcgaccccgatgcc
tttaccaaaaaccgcgcgattgaagaccgtcgcaacgaagaccgctttcacttcatcaac
tggtgcgcaaccgcatttgaaaacgtcaacgtgattccagcgggcaacggcattatgcac
caaatcaaccttgaaaaaatgtcgcccgtgattcaaaaccgcaatggcgtcgccttccca
gacacctgcgtcggcaccgacagccacacgccacacgtcgacgcgctcggcgtgattgcg
attggcgtgggtggtttggaagcagaaaccgtcatgctcggtcgcgcatcgatgatgcgt
ttacccgacattgtcggtgttgaactcacaggcaaacgtcaagcaggcatcaccgccacc
gacatcgtgctcgcattgactgaatacctgcgcaaagaacgcgtggtcggcgcatatgtc
gaattttttggtgaaggcgcagacagcttgtccatcggcgaccgcgccaccatcagcaac
atgacccccgaatacggcgccaccgcagccatgttctacatcgaccaacaaaccattgac
tacctcaagctcacaggccgcgaccctgaacaagtggcattggttgaaaattatgccaaa
accacaggcttatgggcagacgcattaaaaaccgcacaatacccacgcactttgagcttt
gacctctcaacagtgggacgcaacatggcagggccatcgaaccctcacgcacgcgtcgcc
accgccgatttgacagccaaaggcatcgcaggcgcatggacagaaaccgcaggcgaaatg
cccgacggcgcggtcatcatcgccgccatcacctcatgcaccaacacctccaacccacgc
aacaccgtcgccgcaggcctgctcgcccgtaaagccctcgaactcggcctcacgcgcaaa
ccttgggtcaaaacatcgttcgcacccggttcaaaagttgcagaaatctacctcaaagaa
gcaggcgtactcaccgacctcgaacaactcggcttcggcatcgtcgcatttgcctgcacc
acctgcaacggcatgagcggcgcactcgaccccgtgattcagcaagaaatcatcgatcgt
gatctgtacaccaccgccgtactctcaggcaaccgcaacttcgatggccgcatccacccc
tacgccaaacaagccttcctcgcctcaccgccgctcgtcgtcgcctacgcgattgcaggc
acgattcgctttgacatcgaaaacgacgcactcggccacaccgccgacggcacgccgatt
tacctcaaagacatctggcccagcgacgaagacatcgatgcgctggtcgcaaaaagcgtc
caccccgaacaattccgcaaaatttacatccccatgtttgacgcaggcaaagccgaaaaa
tcaatcagcccactgtacgactggcgcgaaatgagcacctacatccgccgcccaccatac
tgggaaggcgcactcgcaggcgaacgcacgctcaaaggcatgcgcccgctcgccgtcctg
cccgacaacatcaccaccgaccacctatcgccctccaacgccatcatgatgaacagcgcc
gcaggtgaatatttgcacaaaatgggcgtgcctgaagaagacttcaacagctacgccacc
caccgtggtgaccatttgaccgctcaacgtgcaacttttgccaaccctaaattattcaac
gaaatggtacacaacaccgacggcaccgtcaaacaaggctcactcgcccgcatcgaacct
gaaggcaaagtcacccgcatgtgggaagccatcgaaacctacatggaacgcaaacaaccg
ctcatcatcatcgcaggcgcagactacggccaaggctccagccgcgactgggctgccaaa
ggcgtgcgcctcgcaggcgtcgaagccatcgccgccgaaggatttgagcgcatccaccgc
accaacctcgttggcatgggtgtattgccacttgaatttaaagcaggtacaaaccgtttg
actttaggcttagacggcacagaaacctacgacgtcattggcgaacgcacaccgcgtgct
gatttaacgctggtgattaaccgtaaaaatggcgaacgacttgaagtgccgatgacgtgc
cgattggataccgctgaagaagtggggatttatgaagcaggtggggttttgcagaggttt
gcgcagaatttcttggagggaagtgtgtaa

DBGET integrated database retrieval system