KEGG   Hymenobacter sedentarius: AUC43_05220Help
Entry
AUC43_05220       CDS       T04242                                 

Definition
(GenBank) selenide, water dikinase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
hyg  Hymenobacter sedentarius
Pathway
hyg00450  Selenocompound metabolism
hyg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hyg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AUC43_05220
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hyg03016]
    AUC43_05220
Enzymes [BR:hyg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     AUC43_05220
Transfer RNA biogenesis [BR:hyg03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    AUC43_05220
 Prokaryotic type
    AUC43_05220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: ALW84538
UniProt: A0A0U4BLE2
Position
complement(1235068..1236117)
Genome map
AA seq 349 aa AA seqDB search
MTPTTEYKLTQYSHGAGCGCKIAPAVLDQMLHTSIAQPHDERLLVGNTSRDDAAVYDIGG
GEAVISTTDFFMPIVDDAYDFGRIASANAISDVYAMGGRPLMAIAVLGWPVDKLPPEVAR
RVLEGARSICAEAGIPLAGGHSIDSPEPIFGLAVTGMVNIVDLKQNDTATAGSELFLTKP
LGVGILTTAQKKGILRDEDAAIAPAQMMQLNKIGAELSKLDAVTALTDVTGFGLLGHLSE
VCEGSGLTAEIEFSKLPRIAAAEPYLKQGSVPGGTGRNWASYGHKVGTITEEQRVWLCDP
QTSGGLLVCVAPQGREEVLAVFAKHGLALESFGRLRAHHEGEAWVQVHA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgactcccacgacggaatataaactgacccaatacagccacggcgccggctgcggctgc
aaaatcgccccggccgtgctcgaccagatgctgcacaccagcatcgcgcagccccacgac
gagcgcctgctggtgggcaacaccagccgcgacgacgcggcggtgtacgacatcggcggc
ggcgaagcggtgatttcgaccaccgacttcttcatgcccatcgtggacgacgcctacgac
ttcggccgcatcgcctcggccaacgccatttcggacgtgtacgccatgggcggccggccg
ctgatggccattgccgtgttgggctggcccgtagacaagctgccgcccgaagtggcccgc
cgcgtgctggaaggcgcccgcagcatctgtgccgaagccggcattccgctggccggcggc
cacagcatcgactcgcccgagcccatttttggcttggccgtgacgggcatggtgaacatc
gtggacctgaagcagaacgacacggccacggccggctcggagctgtttctgaccaagccg
ctgggcgtgggcatcctcaccacggcgcagaaaaagggcattttgcgagacgaggacgcg
gccattgccccggctcaaatgatgcagctcaataaaattggcgccgagctgagcaagctc
gacgcggtgacggcgctgactgacgtgaccggttttggcttgctgggccacctttcggaa
gtgtgcgaaggcagcggattgacggccgaaattgagttttcgaaattgccccgcatcgcg
gccgccgagccgtatttgaagcagggcagcgtgccgggtggcaccggccgcaactgggcc
agctacggacacaaggtgggcaccatcaccgaagagcagcgcgtgtggctctgcgacccg
cagacctcggggggcttactggtgtgcgtggcgccccaaggccgcgaggaagtgctggcg
gtgtttgccaagcacgggctggcgctggaaagctttgggcggctgcgggcgcaccacgaa
ggcgaggcttgggtgcaggtgcacgcgtag

DBGET integrated database retrieval system