KEGG   Hymenobacter sedentarius: AUC43_11505Help
Entry
AUC43_11505       CDS       T04242                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
hyg  Hymenobacter sedentarius
Pathway
hyg00480  Glutathione metabolism
hyg00590  Arachidonic acid metabolism
hyg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hyg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    AUC43_11505
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AUC43_11505
Enzymes [BR:hyg01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AUC43_11505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin Trypsin_2
Motif
Other DBs
NCBI-ProteinID: ALW85660
UniProt: A0A0U4ABV5
Position
2812869..2813459
Genome map
AA seq 196 aa AA seqDB search
MKKSTLLMLATAAAAVAFIAAKPAQPTSMSNSSETVAAPKSVYDFTVKSIDGKDVKLSQF
KGKKLLIVNTASECGYTPQYKELEELYKKHGDKVTVLGFPANNFGGQEPGTEAQIATFCE
KNYGVTFPLFSKVSVKGDDTAPLYKFLADKTQNGAVDSAPSWNFCKYLVDQNGHVVKFYK
SDVKPLSPELLADIMK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagtccactcttctcatgctggccaccgcagccgcagcagtagctttcatcgca
gcaaaaccagcccaacccacttccatgagcaactcttctgaaaccgtagccgccccgaag
tccgtgtacgatttcaccgtgaaatccatcgacggcaaagacgtgaaattgagccagttt
aaaggcaaaaagctcctgattgtaaacaccgcttcggagtgtggctacacgccgcagtac
aaggaactggaagagctctacaaaaagcacggcgacaaggtgaccgtgctgggtttcccc
gccaacaacttcggcggccaggagcccggcaccgaagcccagattgccaccttctgcgag
aaaaactacggcgtgaccttccccttattcagcaaggtatcggtgaagggcgacgacacg
gccccactctacaagttcctggccgacaagacccagaacggcgccgtagacagcgccccc
agctggaacttctgcaagtacctggtcgaccagaacgggcatgtggtgaaattctacaaa
tcagatgtgaagcccctgagccccgagcttctggccgacattatgaagtag

DBGET integrated database retrieval system