KEGG   Hymenobacter sedentarius: AUC43_17120Help
Entry
AUC43_17120       CDS       T04242                                 

Definition
(GenBank) glycosyl hydrolase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
hyg  Hymenobacter sedentarius
Pathway
hyg00511  Other glycan degradation
hyg00600  Sphingolipid metabolism
hyg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hyg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    AUC43_17120
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AUC43_17120
Enzymes [BR:hyg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     AUC43_17120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydro_59
Motif
Other DBs
NCBI-ProteinID: ALW86648
UniProt: A0A0U4C8N7
Position
4174402..4175874
Genome map
AA seq 490 aa AA seqDB search
MPQKLLPLLVLSALSVGSAAAQKTSKPTPGAPYSAAGKKAKVYTTAANTTQRLAAGDALA
FQPAGQPLETQVCVFVDPGHTFQTMLGIGGALTDASAETFAKLPKAQQQELLQAYYSPTA
GIGYTLARTSIHSSDFSSGSYTYVTDQDAALKTFSVQHDEQFRIPFIKQALAAAGGKLTL
YVSPWSPPGWMKTNGEMLHGGKLLPQYRQAWADYYVKFIQAYEQRGIPVWGLTVQNEPMA
TQTWESCIFTGEDERDFIKSYLGPTLQKGGLGNKKLIAWDHNRDLLYQRTSTVLDDPQAA
KYVWGIGYHWYETWTGSGMLFDNVKRVHETYPDKNLLFTEGCLEKFELAKIDRWDLGEKY
GQSMIGDFNAGTVGWTDWNVLLDETGGPNHVGNFCYAPIIADTKAGKLLYTNAYYYIGHF
SKFIRPGAKRIVSSANRDVLQTTAFRNPDGSVAVVVINQTDKPLDFQLWLAGQGAKTTSA
AHSIMTLVVN
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgccacaaaaactccttcctctcctggtactgtcggcgctgagcgtgggcagcgctgcg
gctcaaaagaccagcaaacccacccctggcgcgccttattcggcggccggcaaaaaggcc
aaggtctacaccacggcggccaataccacccagcgcctcgcggccggcgacgccctcgcc
tttcagcccgccgggcagcccctggaaacccaggtgtgcgtatttgtggaccccgggcac
acgtttcagaccatgctcggtattggcggggcgctcaccgatgcctcggccgaaaccttc
gccaaactgcccaaggcccagcagcaggagttgctgcaggcctactacagccccacggcc
ggcattggctacacgctggcgcgcaccagcatccacagctcggacttttcgagcgggagc
tacacctacgtgaccgaccaggacgcggcgctgaaaacctttagcgtgcagcacgacgag
cagtttcgcattccgttcatcaagcaggccctggcggcggccggcggaaagctcaccctc
tacgtgagcccctggagcccgccgggctggatgaaaaccaacggcgagatgctgcacggc
ggcaagctgctgccccagtaccgccaggcctgggccgactactacgtgaagttcatccag
gcctacgagcagcggggcatcccggtgtggggcctcacggtgcagaacgagcccatggcc
acccaaacctgggagtcgtgcattttcaccggcgaggacgagcgggactttatcaaaagc
tacctcggccccaccctgcaaaagggcggcctgggcaacaaaaagctcattgcctgggac
cacaaccgcgacctgctctaccagcgcaccagcaccgtgctcgacgacccgcaggccgcc
aagtacgtgtggggcatcggctaccactggtacgaaacctggaccggcagcggcatgctc
ttcgacaacgtgaagcgcgtgcacgaaacctaccccgacaaaaacctgctgttcaccgaa
ggctgtctcgaaaagtttgagctggccaaaatcgaccgctgggacctgggcgagaaatac
ggccagtcgatgataggcgacttcaacgccggcaccgtgggctggaccgactggaacgtg
ctgctcgacgaaaccggcggccccaaccacgtgggcaacttctgctacgcccccatcatc
gccgataccaaagccggcaagctcctctacaccaacgcctactactacatcggccacttt
tcgaagttcatccggcccggcgccaagcgcatcgtgagctccgctaaccgcgacgtgctg
caaaccaccgccttccgcaaccccgatggcagcgtagccgtggtggtaataaatcagacc
gacaagcccctggatttccagctgtggctggcgggccaaggggccaaaaccacgtcggct
gcgcactccattatgacgctggtggtaaattga

DBGET integrated database retrieval system