KEGG   Hymenobacter sp. sh-6: D3Y59_00610Help
Entry
D3Y59_00610       CDS       T05656                                 

Gene name
apaG
Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
hyh  Hymenobacter sp. sh-6
Brite
KEGG Orthology (KO) [BR:hyh00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    D3Y59_00610 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF3859
Motif
Other DBs
NCBI-ProteinID: AYA35682
UniProt: A0A3B7QWJ2
Position
complement(154352..154738)
Genome map
AA seq 128 aa AA seqDB search
MNSTTTQGVTVSVSTSYLSEYSSPNQEHFVFAYRIDIRNHSEYTVKLLRRHWHIYDANGV
VREVEGEGVVGQQPTLEPGDAHQYVSGCNLKTGIGKMRGTYLMERVADGRTFEVEIPEFT
LVVPFRLN
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgaactcaacaaccactcagggcgtgacggttagcgtatcgaccagctacctgtccgag
tattcgagccccaaccaggaacatttcgtttttgcttatagaatcgacattcgcaaccac
agcgaatacaccgtgaagctgctacgccgccactggcacatttacgacgccaacggcgtg
gtacgcgaggtagagggcgaaggcgtggtgggccagcaacccaccctcgagcccggcgat
gcgcaccagtacgtatcgggctgtaacctgaaaaccggcatcggcaagatgcgcggcacc
tacctgatggagcgtgtggccgacggccgtacctttgaggtcgaaattcccgagtttacg
ctcgtggtaccgttccgcctcaactaa

DBGET integrated database retrieval system