KEGG   Hymenobacter sp. sh-6: D3Y59_01765Help
Entry
D3Y59_01765       CDS       T05656                                 

Definition
(GenBank) aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
hyh  Hymenobacter sp. sh-6
Pathway
hyh00260  Glycine, serine and threonine metabolism
hyh01100  Metabolic pathways
hyh01110  Biosynthesis of secondary metabolites
hyh01120  Microbial metabolism in diverse environments
hyh01130  Biosynthesis of antibiotics
hyh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hyh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    D3Y59_01765
Enzymes [BR:hyh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     D3Y59_01765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP PhnG Aminotran_5 Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AYA35886
UniProt: A0A3B7R889
Position
complement(432536..433561)
Genome map
AA seq 341 aa AA seqDB search
MIDLRSDTITRPTPAMLEAMFRAQVGDDVYEEDPTVRELENECARRFGMEAGLFCPSGTM
TNQIAIKAHTQPMSEVVCEQTSHIYLWEVGGIAFHSGASVALLPGERGRLTAAQVAAAIR
SENVHYPNTSLISLENTHNRGGGSCYSWQALEEIAELAKSKGIPLHLDGARIFNALVATG
QRSEDYGQLFDSISICLSKGLGTPVGSVLVGTQEFVRKCKRIRKAMGGGWRQAGYLAAAG
LYALENHVERLADDHRRARQLAEALEQAPYVEYVLPAETNLVIFRLREGLTEDQFLAHLG
EFGVKASAFGPQMVRFVTHLDVDDAGIERVLEAIRSVPQYA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatttacgctccgataccattacccgccccacgcctgccatgctggaggccatg
ttccgggcgcaggtaggcgacgatgtgtacgaagaggaccccaccgtgcgcgagctggaa
aacgaatgtgcccgccgctttggcatggaggctggtttgttttgcccctccggcaccatg
acgaaccaaattgccattaaggcgcacacgcagcccatgtcggaggtggtgtgcgagcaa
acctcgcacatttacctctgggaggtgggcggcattgcttttcactcgggtgcttcggtg
gcgctgctgcccggcgagcggggccggctcacggcggcgcaggtagccgcagccatccgt
tccgagaacgtgcactaccccaatactagcctcatcagcctcgaaaacacgcacaaccgc
ggcggcggcagctgctacagctggcaagccctcgaagaaattgccgagctggccaaaagc
aaaggcatcccgctgcacctcgatggcgcccgcatcttcaacgccctggtagccactggc
cagcgcagcgaagactacggccagctcttcgattcaatttcgatttgtttgagcaaaggc
ctgggtacgccggtgggctcggtgctggtgggcacgcaggagttcgttcgcaagtgcaag
cgcatccgcaaggccatgggcggtggctggcgccaagccggctacctggctgccgccggc
ctgtatgccctcgaaaaccacgtggagcgcctcgccgacgaccaccgccgggcccgccaa
ctagccgaagcgctggaacaagcgccctacgtcgagtacgtactgccggccgaaaccaac
ctggtcattttccggctgcgcgagggtcttaccgaagatcagttcttggcgcacctaggc
gagttcggcgtgaaagcctcggcgttcgggccgcaaatggtgcgctttgtaacccacctc
gatgtagacgacgccggcattgagcgcgtgctcgaggccatccgtagtgtgccgcagtac
gcctag

DBGET integrated database retrieval system