KEGG   Hymenobacter sp. sh-6: D3Y59_01985Help
Entry
D3Y59_01985       CDS       T05656                                 

Gene name
murI
Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
hyh  Hymenobacter sp. sh-6
Pathway
hyh00471  D-Glutamine and D-glutamate metabolism
hyh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hyh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    D3Y59_01985 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hyh01011]
    D3Y59_01985 (murI)
Enzymes [BR:hyh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     D3Y59_01985 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:hyh01011]
 Precursor biosynthesis
  Racemase
   D3Y59_01985 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race CPBP
Motif
Other DBs
NCBI-ProteinID: AYA38754
UniProt: A0A3B7R3R0
Position
474983..475795
Genome map
AA seq 270 aa AA seqDB search
MADSRPIGVFDSGIGGLTVARAVNQLLPHERLVYFGDTAHLPYGDKSTAAIQAYSVKICD
LLLRQHCKVILIACNSASAAAYELVREYVGSKARVLNVIDPIVEQVGQHYSGREVGLIGT
KQTVGSNVYRKKLDRLDRDIRLHALATPLLAPMIEEGFVRGAVSQSVINTYLSDPALEGI
EALVLACTHYPLIREQIAEYYQGCVDVLDPSHTVALALQHLLQTHSLVAAPAERPPQHHF
YVSDFTPSFEESTRLFFGQEVNLEHYPLWE
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
ctggccgattcgcgccctattggggtttttgacagcggtatcggcggccttacggtggcc
cgcgccgtaaaccagctgctgccccacgagcggctggtgtacttcggcgataccgcgcat
ttgccctacggcgacaaatcgacggcggccatacaggcctacagcgtcaagatctgcgat
ttgcttttgcgccagcattgcaaggttattctcattgcctgcaactcggcttcggcggcg
gcctacgagctggtgcgcgagtacgtgggctctaaagcgcgcgtgctaaacgtaattgac
ccaattgtggagcaagtaggccagcactactctgggcgcgaggtaggcctgattggaacc
aagcaaaccgtgggctccaacgtgtaccgcaaaaagctcgaccgcctcgaccgcgacatc
cggctgcacgctttggccacgccgctgttggcccccatgatcgaggaaggcttcgtgcgc
ggcgctgttagccaaagcgtcatcaacacgtatttgtcagaccccgcgctggagggcatc
gaggcgttggtgctggcgtgcacgcactacccgctaattcgcgagcaaattgccgagtac
taccagggctgcgtcgatgtgctcgatccttcgcacacggtagcgctggcgctgcagcac
ttgttgcaaacgcacagcttggtggctgcgccggccgagcgcccgccgcagcaccatttc
tacgtatccgattttacgccttcgttcgaagaaagcacccgcttgttttttgggcaagaa
gtaaacctcgagcattacccgctctgggagtag

DBGET integrated database retrieval system